Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   RW107_RS16805 Genome accession   NZ_CP136257
Coordinates   3230007..3230147 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain A9     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3225007..3235147
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RW107_RS16780 (RW107_16780) yuxO 3225284..3225664 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  RW107_RS16785 (RW107_16785) comA 3225683..3226327 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  RW107_RS16790 (RW107_16790) - 3226408..3228720 (-) 2313 Protein_3251 histidine kinase -
  RW107_RS16795 (RW107_16795) comX 3228736..3228957 (-) 222 WP_014480704.1 competence pheromone ComX -
  RW107_RS16800 (RW107_16800) - 3228959..3229822 (-) 864 WP_043858576.1 polyprenyl synthetase family protein -
  RW107_RS16805 (RW107_16805) degQ 3230007..3230147 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  RW107_RS16810 (RW107_16810) - 3230369..3230431 (+) 63 Protein_3255 hypothetical protein -
  RW107_RS16815 (RW107_16815) - 3230610..3230978 (+) 369 WP_041850584.1 hypothetical protein -
  RW107_RS16820 (RW107_16820) pdeH 3230954..3232183 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  RW107_RS16825 (RW107_16825) pncB 3232320..3233792 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  RW107_RS16830 (RW107_16830) pncA 3233808..3234359 (-) 552 WP_038828671.1 cysteine hydrolase family protein -
  RW107_RS16835 (RW107_16835) yueI 3234456..3234854 (-) 399 WP_032726794.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=889910 RW107_RS16805 WP_003220708.1 3230007..3230147(-) (degQ) [Bacillus subtilis strain A9]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=889910 RW107_RS16805 WP_003220708.1 3230007..3230147(-) (degQ) [Bacillus subtilis strain A9]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1