Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   RW107_RS12520 Genome accession   NZ_CP136257
Coordinates   2465748..2465921 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain A9     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2460748..2470921
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RW107_RS12505 (RW107_12505) gcvT 2461546..2462634 (-) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -
  RW107_RS12510 (RW107_12510) hepAA 2463076..2464749 (+) 1674 WP_038829735.1 DEAD/DEAH box helicase -
  RW107_RS12515 (RW107_12515) yqhG 2464770..2465564 (+) 795 WP_249385575.1 YqhG family protein -
  RW107_RS12520 (RW107_12520) sinI 2465748..2465921 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  RW107_RS12525 (RW107_12525) sinR 2465955..2466290 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  RW107_RS12530 (RW107_12530) tasA 2466382..2467167 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  RW107_RS12535 (RW107_12535) sipW 2467232..2467804 (-) 573 WP_077671469.1 signal peptidase I SipW -
  RW107_RS12540 (RW107_12540) tapA 2467788..2468549 (-) 762 WP_032726156.1 amyloid fiber anchoring/assembly protein TapA -
  RW107_RS12545 (RW107_12545) yqzG 2468821..2469147 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  RW107_RS12550 (RW107_12550) spoIITA 2469189..2469368 (-) 180 WP_014480252.1 YqzE family protein -
  RW107_RS12555 (RW107_12555) comGG 2469440..2469814 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  RW107_RS12560 (RW107_12560) comGF 2469815..2470198 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  RW107_RS12565 (RW107_12565) comGE 2470224..2470571 (-) 348 WP_021480020.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=889887 RW107_RS12520 WP_014477323.1 2465748..2465921(+) (sinI) [Bacillus subtilis strain A9]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=889887 RW107_RS12520 WP_014477323.1 2465748..2465921(+) (sinI) [Bacillus subtilis strain A9]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982