Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   RW107_RS12560 Genome accession   NZ_CP136257
Coordinates   2469815..2470198 (-) Length   127 a.a.
NCBI ID   WP_032726158.1    Uniprot ID   A0AAX3RJE0
Organism   Bacillus subtilis strain A9     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2464815..2475198
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RW107_RS12520 (RW107_12520) sinI 2465748..2465921 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  RW107_RS12525 (RW107_12525) sinR 2465955..2466290 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  RW107_RS12530 (RW107_12530) tasA 2466382..2467167 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  RW107_RS12535 (RW107_12535) sipW 2467232..2467804 (-) 573 WP_077671469.1 signal peptidase I SipW -
  RW107_RS12540 (RW107_12540) tapA 2467788..2468549 (-) 762 WP_032726156.1 amyloid fiber anchoring/assembly protein TapA -
  RW107_RS12545 (RW107_12545) yqzG 2468821..2469147 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  RW107_RS12550 (RW107_12550) spoIITA 2469189..2469368 (-) 180 WP_014480252.1 YqzE family protein -
  RW107_RS12555 (RW107_12555) comGG 2469440..2469814 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  RW107_RS12560 (RW107_12560) comGF 2469815..2470198 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  RW107_RS12565 (RW107_12565) comGE 2470224..2470571 (-) 348 WP_021480020.1 ComG operon protein 5 Machinery gene
  RW107_RS12570 (RW107_12570) comGD 2470555..2470986 (-) 432 WP_038829732.1 comG operon protein ComGD Machinery gene
  RW107_RS12575 (RW107_12575) comGC 2470976..2471272 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  RW107_RS12580 (RW107_12580) comGB 2471286..2472323 (-) 1038 WP_077671432.1 comG operon protein ComGB Machinery gene
  RW107_RS12585 (RW107_12585) comGA 2472310..2473380 (-) 1071 WP_070547533.1 competence protein ComGA Machinery gene
  RW107_RS12590 (RW107_12590) - 2473608..2473790 (-) 183 WP_033884706.1 hypothetical protein -
  RW107_RS12595 (RW107_12595) corA 2473792..2474745 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14315.39 Da        Isoelectric Point: 5.8929

>NTDB_id=889890 RW107_RS12560 WP_032726158.1 2469815..2470198(-) (comGF) [Bacillus subtilis strain A9]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=889890 RW107_RS12560 WP_032726158.1 2469815..2470198(-) (comGF) [Bacillus subtilis strain A9]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTATCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992