Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   RWA14_RS09150 Genome accession   NZ_CP136120
Coordinates   1911719..1912204 (-) Length   161 a.a.
NCBI ID   WP_260207825.1    Uniprot ID   -
Organism   Lacticaseibacillus rhamnosus strain LMG 10768     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1867709..1920171 1911719..1912204 within 0


Gene organization within MGE regions


Location: 1867709..1920171
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RWA14_RS08895 (RWA14_08895) - 1867709..1868233 (+) 525 WP_005712803.1 DUF3278 domain-containing protein -
  RWA14_RS08900 (RWA14_08900) - 1868466..1872068 (-) 3603 WP_316050928.1 LysM peptidoglycan-binding domain-containing protein -
  RWA14_RS08905 (RWA14_08905) - 1872725..1873051 (+) 327 WP_005712805.1 helix-turn-helix domain-containing protein -
  RWA14_RS08910 (RWA14_08910) - 1873460..1874167 (-) 708 WP_005714633.1 plasmid pRiA4b ORF-3 family protein -
  RWA14_RS08915 (RWA14_08915) - 1874461..1874850 (-) 390 WP_005712808.1 transposase -
  RWA14_RS13760 - 1874894..1875298 (-) 405 WP_318646660.1 transposase -
  RWA14_RS08920 (RWA14_08920) - 1875801..1876091 (+) 291 WP_316050929.1 helix-turn-helix transcriptional regulator -
  RWA14_RS08925 (RWA14_08925) - 1876270..1877274 (+) 1005 WP_020751975.1 Dam family site-specific DNA-(adenine-N6)-methyltransferase -
  RWA14_RS08930 (RWA14_08930) - 1877267..1878106 (-) 840 WP_005714635.1 type II restriction endonuclease -
  RWA14_RS08935 (RWA14_08935) - 1878187..1880532 (-) 2346 WP_005712819.1 ATP-binding protein -
  RWA14_RS08940 (RWA14_08940) - 1880712..1881941 (-) 1230 WP_005712821.1 DNA methyltransferase -
  RWA14_RS08945 (RWA14_08945) - 1882415..1883467 (-) 1053 WP_316050930.1 N-acetylmuramoyl-L-alanine amidase -
  RWA14_RS08950 (RWA14_08950) - 1883469..1883741 (-) 273 WP_316050931.1 holin -
  RWA14_RS08955 (RWA14_08955) - 1883731..1883973 (-) 243 WP_316050932.1 hypothetical protein -
  RWA14_RS08960 (RWA14_08960) - 1883954..1884340 (-) 387 WP_316050933.1 hypothetical protein -
  RWA14_RS08965 (RWA14_08965) - 1884362..1887517 (-) 3156 WP_316050934.1 CotH kinase family protein -
  RWA14_RS08970 (RWA14_08970) - 1887486..1889594 (-) 2109 WP_316050935.1 phage tail protein -
  RWA14_RS08975 (RWA14_08975) - 1889607..1890872 (-) 1266 WP_316050936.1 phage tail domain-containing protein -
  RWA14_RS08980 (RWA14_08980) - 1890876..1893872 (-) 2997 WP_316050937.1 phage tail tape measure protein -
  RWA14_RS08985 (RWA14_08985) - 1893872..1894087 (-) 216 WP_316050938.1 hypothetical protein -
  RWA14_RS08990 (RWA14_08990) - 1894177..1894617 (-) 441 WP_316050939.1 tail assembly chaperone -
  RWA14_RS08995 (RWA14_08995) - 1894681..1895307 (-) 627 WP_316050940.1 phage major tail protein, TP901-1 family -
  RWA14_RS09000 (RWA14_09000) - 1895309..1895674 (-) 366 WP_316050941.1 hypothetical protein -
  RWA14_RS09005 (RWA14_09005) - 1895671..1896045 (-) 375 WP_316050942.1 HK97-gp10 family putative phage morphogenesis protein -
  RWA14_RS09010 (RWA14_09010) - 1896334..1896672 (-) 339 WP_316050943.1 phage head-tail connector protein -
  RWA14_RS09015 (RWA14_09015) - 1896672..1897550 (-) 879 WP_316050944.1 hypothetical protein -
  RWA14_RS09020 (RWA14_09020) - 1897618..1898535 (-) 918 WP_316050945.1 phage capsid protein -
  RWA14_RS09025 (RWA14_09025) - 1898549..1899091 (-) 543 WP_316050946.1 DUF4355 domain-containing protein -
  RWA14_RS09030 (RWA14_09030) - 1899232..1899459 (-) 228 WP_316050947.1 hypothetical protein -
  RWA14_RS09035 (RWA14_09035) - 1899469..1900281 (-) 813 WP_316050948.1 minor capsid protein -
  RWA14_RS09040 (RWA14_09040) - 1900205..1901725 (-) 1521 WP_316050949.1 phage portal protein -
  RWA14_RS09045 (RWA14_09045) - 1901727..1903025 (-) 1299 WP_316050950.1 PBSX family phage terminase large subunit -
  RWA14_RS09050 (RWA14_09050) - 1903009..1903560 (-) 552 WP_316050951.1 terminase small subunit -
  RWA14_RS09055 (RWA14_09055) - 1903597..1903917 (-) 321 WP_064535090.1 hypothetical protein -
  RWA14_RS09060 (RWA14_09060) - 1903910..1904488 (-) 579 WP_064535088.1 NUMOD4 domain-containing protein -
  RWA14_RS09065 (RWA14_09065) - 1904475..1905692 (-) 1218 WP_316050952.1 GcrA family cell cycle regulator -
  RWA14_RS09070 (RWA14_09070) - 1906032..1906460 (-) 429 WP_316050953.1 ArpU family phage packaging/lysis transcriptional regulator -
  RWA14_RS09075 (RWA14_09075) - 1906574..1906885 (-) 312 WP_316050954.1 hypothetical protein -
  RWA14_RS09080 (RWA14_09080) - 1907133..1907420 (-) 288 WP_316050955.1 hypothetical protein -
  RWA14_RS09085 (RWA14_09085) - 1907417..1907899 (-) 483 WP_316050956.1 YopX family protein -
  RWA14_RS09090 (RWA14_09090) - 1907910..1908140 (-) 231 WP_316050957.1 hypothetical protein -
  RWA14_RS09095 (RWA14_09095) - 1908185..1908373 (-) 189 WP_316050958.1 hypothetical protein -
  RWA14_RS09100 (RWA14_09100) - 1908370..1908744 (-) 375 WP_316050959.1 DUF1642 domain-containing protein -
  RWA14_RS09105 (RWA14_09105) - 1908741..1908950 (-) 210 WP_316050960.1 hypothetical protein -
  RWA14_RS09110 (RWA14_09110) - 1908940..1909152 (-) 213 WP_070598478.1 hypothetical protein -
  RWA14_RS09115 (RWA14_09115) - 1909142..1909318 (-) 177 WP_168163029.1 hypothetical protein -
  RWA14_RS09120 (RWA14_09120) - 1909308..1909838 (-) 531 WP_316050961.1 DUF1642 domain-containing protein -
  RWA14_RS09125 (RWA14_09125) - 1909835..1910245 (-) 411 WP_039141129.1 hypothetical protein -
  RWA14_RS09130 (RWA14_09130) - 1910242..1910352 (-) 111 WP_039141128.1 hypothetical protein -
  RWA14_RS09135 (RWA14_09135) - 1910364..1910747 (-) 384 WP_070598482.1 DUF1064 domain-containing protein -
  RWA14_RS09140 (RWA14_09140) - 1910750..1911199 (-) 450 WP_316050962.1 hypothetical protein -
  RWA14_RS09145 (RWA14_09145) - 1911196..1911411 (-) 216 WP_260207826.1 helix-turn-helix transcriptional regulator -
  RWA14_RS09150 (RWA14_09150) ssb 1911719..1912204 (-) 486 WP_260207825.1 single-stranded DNA-binding protein Machinery gene
  RWA14_RS09155 (RWA14_09155) - 1912217..1913173 (-) 957 WP_260207824.1 DnaD domain protein -
  RWA14_RS09160 (RWA14_09160) - 1913189..1913989 (-) 801 WP_083311080.1 PD-(D/E)XK nuclease-like domain-containing protein -
  RWA14_RS09165 (RWA14_09165) - 1913970..1914833 (-) 864 WP_033573212.1 recombinase RecT -
  RWA14_RS09170 (RWA14_09170) - 1914845..1915270 (-) 426 WP_049168935.1 hypothetical protein -
  RWA14_RS09175 (RWA14_09175) - 1915263..1915490 (-) 228 WP_316050963.1 hypothetical protein -
  RWA14_RS09180 (RWA14_09180) - 1915502..1915630 (-) 129 WP_005711343.1 hypothetical protein -
  RWA14_RS09185 (RWA14_09185) - 1915643..1915852 (-) 210 WP_064657612.1 hypothetical protein -
  RWA14_RS09190 (RWA14_09190) - 1915858..1916364 (-) 507 WP_316050964.1 hypothetical protein -
  RWA14_RS09195 (RWA14_09195) - 1916422..1916580 (-) 159 WP_316050965.1 hypothetical protein -
  RWA14_RS09200 (RWA14_09200) - 1916577..1916843 (-) 267 WP_316050966.1 helix-turn-helix transcriptional regulator -
  RWA14_RS09205 (RWA14_09205) - 1916993..1917421 (+) 429 WP_263932484.1 helix-turn-helix domain-containing protein -
  RWA14_RS09210 (RWA14_09210) - 1917441..1917881 (+) 441 WP_263932485.1 ImmA/IrrE family metallo-endopeptidase -
  RWA14_RS09215 (RWA14_09215) - 1917912..1918481 (+) 570 WP_263932486.1 hypothetical protein -
  RWA14_RS09220 (RWA14_09220) - 1918537..1918902 (+) 366 WP_263932487.1 hypothetical protein -
  RWA14_RS09225 (RWA14_09225) - 1919008..1920171 (+) 1164 WP_316050967.1 tyrosine-type recombinase/integrase -

Sequence

Protein


Download         Length: 161 a.a.        Molecular weight: 17540.26 Da        Isoelectric Point: 8.0035

>NTDB_id=888658 RWA14_RS09150 WP_260207825.1 1911719..1912204(-) (ssb) [Lacticaseibacillus rhamnosus strain LMG 10768]
MLNSVSLTGRLTRDVDLRYTQSGTAAGSFTLAVDRKFKSKTGERETDFINCQIWRKSAENFANFTKKGSLVGVEGHIQTR
TYNNAQGQKVFVTEVIVDNFALLESRQASQNNPKSQQTANASAAATTNASQTTPNASRANTTDPFANNGQPLDISDDDLP
F

Nucleotide


Download         Length: 486 bp        

>NTDB_id=888658 RWA14_RS09150 WP_260207825.1 1911719..1912204(-) (ssb) [Lacticaseibacillus rhamnosus strain LMG 10768]
TTGCTAAACAGTGTCTCACTAACAGGCCGGCTGACAAGAGATGTTGACTTGCGTTACACGCAAAGTGGCACGGCGGCAGG
ATCATTCACGCTGGCCGTTGATCGCAAATTCAAGAGCAAAACCGGAGAACGAGAAACTGATTTCATAAATTGCCAGATCT
GGCGCAAGTCGGCTGAGAACTTTGCAAACTTCACCAAAAAAGGATCCTTGGTTGGTGTGGAAGGCCATATCCAAACGCGC
ACGTATAATAACGCGCAAGGGCAGAAAGTATTCGTTACCGAGGTAATCGTTGATAATTTTGCTTTGCTTGAGTCACGACA
GGCGTCTCAGAACAACCCTAAATCACAGCAAACAGCCAATGCATCAGCAGCAGCGACCACAAACGCGAGTCAAACGACTC
CAAATGCTTCACGAGCGAATACCACGGATCCGTTTGCTAATAATGGCCAGCCACTCGATATTTCTGATGATGATTTGCCA
TTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-102)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

62.791

100

0.671
  ssbA Bacillus subtilis subsp. subtilis str. 168

50

100

0.534