Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   RS399_RS19635 Genome accession   NZ_CP135973
Coordinates   3876921..3877094 (-) Length   57 a.a.
NCBI ID   WP_003226347.1    Uniprot ID   G4NQ83
Organism   Bacillus inaquosorum strain SI3     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3871921..3882094
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RS399_RS19590 (RS399_19590) comGE 3872266..3872613 (+) 348 WP_084993724.1 competence type IV pilus minor pilin ComGE Machinery gene
  RS399_RS19595 (RS399_19595) comGF 3872639..3873022 (+) 384 WP_084993726.1 competence type IV pilus minor pilin ComGF Machinery gene
  RS399_RS19600 (RS399_19600) comGG 3873023..3873397 (+) 375 WP_084993728.1 competence type IV pilus minor pilin ComGG Machinery gene
  RS399_RS19605 (RS399_19605) - 3873468..3873647 (+) 180 WP_003236949.1 YqzE family protein -
  RS399_RS19610 (RS399_19610) - 3873689..3874015 (-) 327 WP_029316858.1 YqzG/YhdC family protein -
  RS399_RS19615 (RS399_19615) tapA 3874288..3875052 (+) 765 WP_084993730.1 amyloid fiber anchoring/assembly protein TapA -
  RS399_RS19620 (RS399_19620) sipW 3875036..3875608 (+) 573 WP_080010845.1 signal peptidase I SipW -
  RS399_RS19625 (RS399_19625) tasA 3875672..3876457 (+) 786 WP_003236939.1 biofilm matrix protein TasA -
  RS399_RS19630 (RS399_19630) sinR 3876552..3876887 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  RS399_RS19635 (RS399_19635) sinI 3876921..3877094 (-) 174 WP_003226347.1 anti-repressor SinI Regulator
  RS399_RS19640 (RS399_19640) - 3877279..3878073 (-) 795 WP_003236936.1 YqhG family protein -
  RS399_RS19645 (RS399_19645) - 3878094..3879767 (-) 1674 WP_003236934.1 DEAD/DEAH box helicase -
  RS399_RS19650 (RS399_19650) gcvT 3880211..3881299 (+) 1089 WP_084993733.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6632.64 Da        Isoelectric Point: 8.6596

>NTDB_id=888057 RS399_RS19635 WP_003226347.1 3876921..3877094(-) (sinI) [Bacillus inaquosorum strain SI3]
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=888057 RS399_RS19635 WP_003226347.1 3876921..3877094(-) (sinI) [Bacillus inaquosorum strain SI3]
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4NQ83

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

96.491

100

0.965