Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   RS399_RS19600 Genome accession   NZ_CP135973
Coordinates   3873023..3873397 (+) Length   124 a.a.
NCBI ID   WP_084993728.1    Uniprot ID   -
Organism   Bacillus inaquosorum strain SI3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3868023..3878397
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RS399_RS19560 (RS399_19560) - 3868831..3869241 (+) 411 WP_084993718.1 CBS domain-containing protein -
  RS399_RS19565 (RS399_19565) - 3869264..3869494 (+) 231 WP_315957522.1 hypothetical protein -
  RS399_RS19570 (RS399_19570) comGA 3869457..3870527 (+) 1071 WP_003236962.1 competence protein ComGA Machinery gene
  RS399_RS19575 (RS399_19575) comGB 3870514..3871551 (+) 1038 WP_084993720.1 competence type IV pilus assembly protein ComGB Machinery gene
  RS399_RS19580 (RS399_19580) comGC 3871565..3871861 (+) 297 WP_003236957.1 comG operon protein ComGC Machinery gene
  RS399_RS19585 (RS399_19585) comGD 3871851..3872282 (+) 432 WP_084993722.1 competence type IV pilus minor pilin ComGD Machinery gene
  RS399_RS19590 (RS399_19590) comGE 3872266..3872613 (+) 348 WP_084993724.1 competence type IV pilus minor pilin ComGE Machinery gene
  RS399_RS19595 (RS399_19595) comGF 3872639..3873022 (+) 384 WP_084993726.1 competence type IV pilus minor pilin ComGF Machinery gene
  RS399_RS19600 (RS399_19600) comGG 3873023..3873397 (+) 375 WP_084993728.1 competence type IV pilus minor pilin ComGG Machinery gene
  RS399_RS19605 (RS399_19605) - 3873468..3873647 (+) 180 WP_003236949.1 YqzE family protein -
  RS399_RS19610 (RS399_19610) - 3873689..3874015 (-) 327 WP_029316858.1 YqzG/YhdC family protein -
  RS399_RS19615 (RS399_19615) tapA 3874288..3875052 (+) 765 WP_084993730.1 amyloid fiber anchoring/assembly protein TapA -
  RS399_RS19620 (RS399_19620) sipW 3875036..3875608 (+) 573 WP_080010845.1 signal peptidase I SipW -
  RS399_RS19625 (RS399_19625) tasA 3875672..3876457 (+) 786 WP_003236939.1 biofilm matrix protein TasA -
  RS399_RS19630 (RS399_19630) sinR 3876552..3876887 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  RS399_RS19635 (RS399_19635) sinI 3876921..3877094 (-) 174 WP_003226347.1 anti-repressor SinI Regulator
  RS399_RS19640 (RS399_19640) - 3877279..3878073 (-) 795 WP_003236936.1 YqhG family protein -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14291.51 Da        Isoelectric Point: 10.2570

>NTDB_id=888055 RS399_RS19600 WP_084993728.1 3873023..3873397(+) (comGG) [Bacillus inaquosorum strain SI3]
MYRSKGFIYPAVLFVSALVLLIVNFTAAQYISRCMFEKETKAFYTGENLLQNGALLSIRHVLEQRKGQKGSQQFTYGQVS
YHIHNTSIKEQKQISLKAITESGAERNAQLVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=888055 RS399_RS19600 WP_084993728.1 3873023..3873397(+) (comGG) [Bacillus inaquosorum strain SI3]
ATGTACCGTTCGAAAGGATTTATTTATCCCGCTGTTCTTTTTGTCTCCGCGCTTGTGCTGCTGATCGTAAACTTTACTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGCGTTTTATACAGGAGAAAATTTGCTTCAGAATGGCG
CACTTCTTTCAATTCGGCATGTTCTTGAGCAGCGGAAAGGCCAAAAGGGTTCACAGCAGTTTACATATGGGCAGGTTTCT
TATCACATTCACAATACATCGATAAAAGAGCAAAAACAAATCAGCTTAAAAGCCATTACGGAGTCGGGAGCAGAAAGAAA
TGCACAGCTAGTGTTCGATCAAAAACAGAAAAAACTGCTGCGCTGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

81.452

100

0.815