Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   RUL31_RS13125 Genome accession   NZ_CP135964
Coordinates   2699658..2700005 (-) Length   115 a.a.
NCBI ID   WP_088117570.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain CD303     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2694658..2705005
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RUL31_RS13080 (RUL31_13080) sinI 2695155..2695328 (+) 174 WP_094232412.1 anti-repressor SinI Regulator
  RUL31_RS13085 (RUL31_13085) sinR 2695362..2695697 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  RUL31_RS13090 (RUL31_13090) tasA 2695889..2696671 (-) 783 WP_063638541.1 biofilm matrix protein TasA -
  RUL31_RS13095 (RUL31_13095) sipW 2696736..2697308 (-) 573 WP_010789195.1 signal peptidase I SipW -
  RUL31_RS13100 (RUL31_13100) tapA 2697292..2697993 (-) 702 WP_315915357.1 amyloid fiber anchoring/assembly protein TapA -
  RUL31_RS13105 (RUL31_13105) - 2698255..2698578 (+) 324 WP_088117568.1 DUF3889 domain-containing protein -
  RUL31_RS13110 (RUL31_13110) - 2698625..2698804 (-) 180 WP_003325435.1 YqzE family protein -
  RUL31_RS13115 (RUL31_13115) comGG 2698874..2699248 (-) 375 WP_088117569.1 competence type IV pilus minor pilin ComGG Machinery gene
  RUL31_RS13120 (RUL31_13120) comGF 2699249..2699644 (-) 396 WP_309484978.1 competence type IV pilus minor pilin ComGF Machinery gene
  RUL31_RS13125 (RUL31_13125) comGE 2699658..2700005 (-) 348 WP_088117570.1 competence type IV pilus minor pilin ComGE Machinery gene
  RUL31_RS13130 (RUL31_13130) comGD 2699989..2700429 (-) 441 WP_390840628.1 competence type IV pilus minor pilin ComGD Machinery gene
  RUL31_RS13135 (RUL31_13135) comGC 2700419..2700718 (-) 300 WP_003325429.1 competence type IV pilus major pilin ComGC Machinery gene
  RUL31_RS13140 (RUL31_13140) comGB 2700733..2701770 (-) 1038 WP_315915363.1 competence type IV pilus assembly protein ComGB Machinery gene
  RUL31_RS13145 (RUL31_13145) comGA 2701757..2702827 (-) 1071 WP_106270996.1 competence type IV pilus ATPase ComGA Machinery gene
  RUL31_RS13150 (RUL31_13150) - 2703207..2704160 (-) 954 WP_088117575.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 115 a.a.        Molecular weight: 13326.25 Da        Isoelectric Point: 4.5702

>NTDB_id=887827 RUL31_RS13125 WP_088117570.1 2699658..2700005(-) (comGE) [Bacillus atrophaeus strain CD303]
MWKENKGFSTIETVAALSTWVLITVMILPLWARLISDEKETAIQETGYQLLHESISTYMLSGEYGKSETIKRLNQTYKVR
WEEDGDNQKVCMEAVSPKDEPFCLSILRTDWLYPS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=887827 RUL31_RS13125 WP_088117570.1 2699658..2700005(-) (comGE) [Bacillus atrophaeus strain CD303]
ATGTGGAAAGAAAATAAAGGCTTCTCAACAATTGAAACAGTCGCGGCTTTAAGCACTTGGGTATTGATTACAGTGATGAT
TCTTCCTTTGTGGGCCAGACTGATATCAGATGAAAAAGAGACAGCCATTCAGGAAACCGGTTATCAGCTTCTTCACGAAA
GCATCAGTACATACATGCTTTCTGGAGAGTACGGAAAATCAGAGACAATAAAAAGGCTGAACCAAACCTATAAGGTCAGG
TGGGAGGAGGATGGCGACAATCAAAAAGTATGTATGGAAGCGGTCAGCCCGAAGGACGAGCCCTTTTGTCTCAGCATTCT
TCGGACAGACTGGTTATACCCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

51.304

100

0.513