Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | RUL31_RS13080 | Genome accession | NZ_CP135964 |
| Coordinates | 2695155..2695328 (+) | Length | 57 a.a. |
| NCBI ID | WP_094232412.1 | Uniprot ID | - |
| Organism | Bacillus atrophaeus strain CD303 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2690155..2700328
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RUL31_RS13065 (RUL31_13065) | gcvT | 2690925..2692019 (-) | 1095 | WP_106360542.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| RUL31_RS13070 (RUL31_13070) | - | 2692480..2694150 (+) | 1671 | WP_094232410.1 | DEAD/DEAH box helicase | - |
| RUL31_RS13075 (RUL31_13075) | - | 2694171..2694965 (+) | 795 | WP_315915354.1 | YqhG family protein | - |
| RUL31_RS13080 (RUL31_13080) | sinI | 2695155..2695328 (+) | 174 | WP_094232412.1 | anti-repressor SinI | Regulator |
| RUL31_RS13085 (RUL31_13085) | sinR | 2695362..2695697 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| RUL31_RS13090 (RUL31_13090) | tasA | 2695889..2696671 (-) | 783 | WP_063638541.1 | biofilm matrix protein TasA | - |
| RUL31_RS13095 (RUL31_13095) | sipW | 2696736..2697308 (-) | 573 | WP_010789195.1 | signal peptidase I SipW | - |
| RUL31_RS13100 (RUL31_13100) | tapA | 2697292..2697993 (-) | 702 | WP_315915357.1 | amyloid fiber anchoring/assembly protein TapA | - |
| RUL31_RS13105 (RUL31_13105) | - | 2698255..2698578 (+) | 324 | WP_088117568.1 | DUF3889 domain-containing protein | - |
| RUL31_RS13110 (RUL31_13110) | - | 2698625..2698804 (-) | 180 | WP_003325435.1 | YqzE family protein | - |
| RUL31_RS13115 (RUL31_13115) | comGG | 2698874..2699248 (-) | 375 | WP_088117569.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| RUL31_RS13120 (RUL31_13120) | comGF | 2699249..2699644 (-) | 396 | WP_309484978.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| RUL31_RS13125 (RUL31_13125) | comGE | 2699658..2700005 (-) | 348 | WP_088117570.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6817.90 Da Isoelectric Point: 10.4757
>NTDB_id=887823 RUL31_RS13080 WP_094232412.1 2695155..2695328(+) (sinI) [Bacillus atrophaeus strain CD303]
MKNAKKEFLELDQEWVELMKRAREANINPEEIRKYLNLHKKSARPVPATRSHTINPF
MKNAKKEFLELDQEWVELMKRAREANINPEEIRKYLNLHKKSARPVPATRSHTINPF
Nucleotide
Download Length: 174 bp
>NTDB_id=887823 RUL31_RS13080 WP_094232412.1 2695155..2695328(+) (sinI) [Bacillus atrophaeus strain CD303]
ATGAAAAATGCAAAAAAAGAGTTTTTAGAATTAGATCAAGAATGGGTTGAATTAATGAAAAGAGCCAGAGAAGCAAATAT
CAACCCGGAGGAGATACGCAAATATTTAAATTTGCATAAAAAGTCTGCTCGTCCTGTCCCAGCCACCAGAAGTCATACCA
TAAATCCTTTCTGA
ATGAAAAATGCAAAAAAAGAGTTTTTAGAATTAGATCAAGAATGGGTTGAATTAATGAAAAGAGCCAGAGAAGCAAATAT
CAACCCGGAGGAGATACGCAAATATTTAAATTTGCATAAAAAGTCTGCTCGTCCTGTCCCAGCCACCAGAAGTCATACCA
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
77.193 |
100 |
0.772 |