Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   RUL31_RS13080 Genome accession   NZ_CP135964
Coordinates   2695155..2695328 (+) Length   57 a.a.
NCBI ID   WP_094232412.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain CD303     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2690155..2700328
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RUL31_RS13065 (RUL31_13065) gcvT 2690925..2692019 (-) 1095 WP_106360542.1 glycine cleavage system aminomethyltransferase GcvT -
  RUL31_RS13070 (RUL31_13070) - 2692480..2694150 (+) 1671 WP_094232410.1 DEAD/DEAH box helicase -
  RUL31_RS13075 (RUL31_13075) - 2694171..2694965 (+) 795 WP_315915354.1 YqhG family protein -
  RUL31_RS13080 (RUL31_13080) sinI 2695155..2695328 (+) 174 WP_094232412.1 anti-repressor SinI Regulator
  RUL31_RS13085 (RUL31_13085) sinR 2695362..2695697 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  RUL31_RS13090 (RUL31_13090) tasA 2695889..2696671 (-) 783 WP_063638541.1 biofilm matrix protein TasA -
  RUL31_RS13095 (RUL31_13095) sipW 2696736..2697308 (-) 573 WP_010789195.1 signal peptidase I SipW -
  RUL31_RS13100 (RUL31_13100) tapA 2697292..2697993 (-) 702 WP_315915357.1 amyloid fiber anchoring/assembly protein TapA -
  RUL31_RS13105 (RUL31_13105) - 2698255..2698578 (+) 324 WP_088117568.1 DUF3889 domain-containing protein -
  RUL31_RS13110 (RUL31_13110) - 2698625..2698804 (-) 180 WP_003325435.1 YqzE family protein -
  RUL31_RS13115 (RUL31_13115) comGG 2698874..2699248 (-) 375 WP_088117569.1 competence type IV pilus minor pilin ComGG Machinery gene
  RUL31_RS13120 (RUL31_13120) comGF 2699249..2699644 (-) 396 WP_309484978.1 competence type IV pilus minor pilin ComGF Machinery gene
  RUL31_RS13125 (RUL31_13125) comGE 2699658..2700005 (-) 348 WP_088117570.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6817.90 Da        Isoelectric Point: 10.4757

>NTDB_id=887823 RUL31_RS13080 WP_094232412.1 2695155..2695328(+) (sinI) [Bacillus atrophaeus strain CD303]
MKNAKKEFLELDQEWVELMKRAREANINPEEIRKYLNLHKKSARPVPATRSHTINPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=887823 RUL31_RS13080 WP_094232412.1 2695155..2695328(+) (sinI) [Bacillus atrophaeus strain CD303]
ATGAAAAATGCAAAAAAAGAGTTTTTAGAATTAGATCAAGAATGGGTTGAATTAATGAAAAGAGCCAGAGAAGCAAATAT
CAACCCGGAGGAGATACGCAAATATTTAAATTTGCATAAAAAGTCTGCTCGTCCTGTCCCAGCCACCAGAAGTCATACCA
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

77.193

100

0.772