Detailed information    

insolico Bioinformatically predicted

Overview


Name   rcrQ   Type   Regulator
Locus tag   RSK81_RS12895 Genome accession   NZ_CP135591
Coordinates   195141..195929 (+) Length   262 a.a.
NCBI ID   WP_410530915.1    Uniprot ID   -
Organism   Streptococcus sp. DTU_2020_1000888_1_SI_GRL_NUU_041A     
Function   regulate competence (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 192452..237252 195141..195929 within 0


Gene organization within MGE regions


Location: 192452..237252
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RSK81_RS01035 (RSK81_01035) - 192452..194158 (+) 1707 WP_315687099.1 ABC transporter ATP-binding protein -
  RSK81_RS12885 - 194160..194298 (+) 139 Protein_181 ABC transporter ATP-binding protein -
  RSK81_RS12890 - 194277..195005 (+) 729 Protein_182 ABC transporter ATP-binding protein -
  RSK81_RS12895 rcrQ 195141..195929 (+) 789 WP_410530915.1 ABC transporter ATP-binding protein Regulator
  RSK81_RS01045 (RSK81_01045) amiA 196045..198018 (-) 1974 WP_315687102.1 peptide ABC transporter substrate-binding protein Regulator
  RSK81_RS01050 (RSK81_01050) - 198246..198935 (+) 690 WP_002893948.1 gamma-glutamyl-gamma-aminobutyrate hydrolase family protein -
  RSK81_RS01055 (RSK81_01055) - 199201..199650 (+) 450 WP_125410571.1 8-oxo-dGTP diphosphatase -
  RSK81_RS01060 (RSK81_01060) - 199950..200930 (-) 981 WP_315687105.1 Abi family protein -
  RSK81_RS01065 (RSK81_01065) - 201235..201636 (-) 402 WP_315687107.1 transcriptional regulator -
  RSK81_RS01070 (RSK81_01070) - 201661..202164 (-) 504 WP_315687110.1 hypothetical protein -
  RSK81_RS01075 (RSK81_01075) - 202240..202479 (-) 240 WP_061589317.1 hypothetical protein -
  RSK81_RS01080 (RSK81_01080) - 202485..203081 (-) 597 WP_315687112.1 hypothetical protein -
  RSK81_RS01085 (RSK81_01085) - 203169..203324 (-) 156 WP_315687113.1 DUF2292 domain-containing protein -
  RSK81_RS01090 (RSK81_01090) - 203361..203609 (-) 249 Protein_193 hypothetical protein -
  RSK81_RS01095 (RSK81_01095) - 203623..204168 (-) 546 WP_002913032.1 hypothetical protein -
  RSK81_RS01100 (RSK81_01100) - 204191..204913 (-) 723 WP_315687116.1 ATP-binding protein -
  RSK81_RS01105 (RSK81_01105) - 204925..205746 (-) 822 WP_315687118.1 DnaD domain protein -
  RSK81_RS01110 (RSK81_01110) - 205739..206014 (-) 276 WP_315687119.1 MerR family transcriptional regulator -
  RSK81_RS01115 (RSK81_01115) - 206021..206359 (-) 339 WP_061589313.1 hypothetical protein -
  RSK81_RS01120 (RSK81_01120) - 206361..206612 (-) 252 WP_315687120.1 hypothetical protein -
  RSK81_RS01125 (RSK81_01125) - 206639..206773 (-) 135 WP_260425629.1 hypothetical protein -
  RSK81_RS01130 (RSK81_01130) - 206787..207002 (-) 216 WP_315687122.1 hypothetical protein -
  RSK81_RS01135 (RSK81_01135) - 207205..207834 (-) 630 WP_315687125.1 Rha family transcriptional regulator -
  RSK81_RS01140 (RSK81_01140) - 207849..208046 (-) 198 WP_315687126.1 helix-turn-helix domain-containing protein -
  RSK81_RS01145 (RSK81_01145) - 208197..208691 (+) 495 WP_315687127.1 helix-turn-helix domain-containing protein -
  RSK81_RS01150 (RSK81_01150) - 208805..209473 (+) 669 WP_315687128.1 Fic family protein -
  RSK81_RS01155 (RSK81_01155) - 209574..210308 (+) 735 WP_315687129.1 hypothetical protein -
  RSK81_RS01160 (RSK81_01160) - 210492..211637 (+) 1146 WP_315687130.1 tyrosine-type recombinase/integrase -
  RSK81_RS01165 (RSK81_01165) - 211732..212178 (+) 447 WP_315687132.1 dUTP diphosphatase -
  RSK81_RS01170 (RSK81_01170) - 212180..212695 (+) 516 WP_315687135.1 histidine phosphatase family protein -
  RSK81_RS01175 (RSK81_01175) - 212748..213380 (+) 633 WP_315687137.1 methyltransferase domain-containing protein -
  RSK81_RS01180 (RSK81_01180) radA 213386..214753 (+) 1368 WP_080555828.1 DNA repair protein RadA Machinery gene
  RSK81_RS01185 (RSK81_01185) - 214869..215585 (+) 717 WP_315687139.1 TIGR00266 family protein -
  RSK81_RS01190 (RSK81_01190) - 215699..216394 (+) 696 WP_002899169.1 TIGR00266 family protein -
  RSK81_RS01195 (RSK81_01195) - 216684..217169 (+) 486 WP_002893940.1 GNAT family N-acetyltransferase -
  RSK81_RS01200 (RSK81_01200) - 217333..217830 (+) 498 WP_315687142.1 carbonic anhydrase -
  RSK81_RS01205 (RSK81_01205) - 217928..218794 (+) 867 WP_315687145.1 ABC transporter permease -
  RSK81_RS01210 (RSK81_01210) - 218791..219549 (+) 759 WP_315687146.1 ABC transporter ATP-binding protein -
  RSK81_RS01215 (RSK81_01215) - 219745..221226 (-) 1482 WP_315687743.1 M protein trans-acting positive regulator PRD domain-containing protein -
  RSK81_RS01220 (RSK81_01220) - 221517..221756 (+) 240 WP_002920347.1 GlsB/YeaQ/YmgE family stress response membrane protein -
  RSK81_RS01225 (RSK81_01225) amaP 221812..222393 (+) 582 WP_311153926.1 alkaline shock response membrane anchor protein AmaP -
  RSK81_RS01230 (RSK81_01230) - 222405..222575 (+) 171 WP_002905455.1 DUF2273 domain-containing protein -
  RSK81_RS01235 (RSK81_01235) - 222593..223183 (+) 591 WP_002902153.1 Asp23/Gls24 family envelope stress response protein -
  RSK81_RS01240 (RSK81_01240) - 223260..223463 (+) 204 WP_002899152.1 CsbD family protein -
  RSK81_RS01245 (RSK81_01245) - 224247..225914 (+) 1668 WP_268682386.1 ribonuclease J -
  RSK81_RS01250 (RSK81_01250) - 225989..226768 (+) 780 WP_049552858.1 alpha/beta hydrolase -
  RSK81_RS01255 (RSK81_01255) gltX 226875..228332 (+) 1458 WP_049552859.1 glutamate--tRNA ligase -
  RSK81_RS01260 (RSK81_01260) - 228422..229057 (+) 636 WP_049552860.1 DUF6287 domain-containing protein -
  RSK81_RS01265 (RSK81_01265) - 229232..230431 (+) 1200 WP_268697475.1 argininosuccinate synthase -
  RSK81_RS01270 (RSK81_01270) argH 230447..231832 (+) 1386 WP_002907898.1 argininosuccinate lyase -
  RSK81_RS01275 (RSK81_01275) rnpA 231981..232340 (+) 360 WP_315687151.1 ribonuclease P protein component -
  RSK81_RS01280 (RSK81_01280) - 232324..233139 (+) 816 WP_315687153.1 YidC/Oxa1 family membrane protein insertase -
  RSK81_RS01285 (RSK81_01285) jag 233161..234186 (+) 1026 WP_315687154.1 RNA-binding cell elongation regulator Jag/EloR -
  RSK81_RS01290 (RSK81_01290) - 234235..234867 (+) 633 WP_315687156.1 HI_0552 family protein -
  RSK81_RS01295 (RSK81_01295) rpmH 235006..235140 (+) 135 WP_002893904.1 50S ribosomal protein L34 -
  RSK81_RS01300 (RSK81_01300) - 235202..235510 (-) 309 Protein_235 transcriptional regulator -
  RSK81_RS01305 (RSK81_01305) - 235619..237034 (-) 1416 WP_315687158.1 DUF4153 domain-containing protein -
  RSK81_RS01310 (RSK81_01310) - 237037..237252 (-) 216 WP_002893895.1 helix-turn-helix domain-containing protein -

Sequence


Protein


Download         Length: 262 a.a.        Molecular weight: 29196.89 Da        Isoelectric Point: 4.4043

>NTDB_id=887068 RSK81_RS12895 WP_410530915.1 195141..195929(+) (rcrQ) [Streptococcus sp. DTU_2020_1000888_1_SI_GRL_NUU_041A]
MFDAPEEVRPENAPAFIELTDSVEIKHVDFSYVEGKPILKDVSILAPKGKMTAVVGPTGSGKTTIMNLLNRFYDVDNGSI
EFDGRDIRDYELDSLRSHVGIVLQDSVLFSGTIRDNIRFGVPDASQEMVETAARATHIHDYIESLPDKYDTLVDDDQNIF
STGQKQLISIARTLLTDPQVLILDEATSNVDTVTESKIQQAMEAVVAGRTSFVIAHRLKTILNADQIIVLKDGEVIEQGD
HHQLLKLGGFYSELYHNQFVFE

Nucleotide


Download         Length: 789 bp        

>NTDB_id=887068 RSK81_RS12895 WP_410530915.1 195141..195929(+) (rcrQ) [Streptococcus sp. DTU_2020_1000888_1_SI_GRL_NUU_041A]
ATGTTTGATGCACCAGAGGAAGTCCGGCCAGAGAATGCACCTGCTTTCATAGAGCTTACAGACTCCGTGGAGATCAAGCA
TGTGGACTTCTCTTATGTAGAAGGCAAGCCTATTCTCAAAGACGTATCTATTTTAGCCCCTAAGGGCAAGATGACGGCTG
TTGTTGGCCCGACTGGATCAGGTAAGACGACCATTATGAACCTGCTTAATCGCTTTTATGATGTGGATAATGGCAGTATC
GAGTTTGACGGTCGTGACATTCGAGATTATGAGCTGGATAGCCTACGGAGCCATGTGGGGATTGTCTTGCAGGATTCGGT
GCTCTTTAGTGGTACGATTCGGGACAATATCCGCTTCGGTGTGCCGGATGCCAGTCAGGAGATGGTAGAAACGGCTGCGC
GTGCGACCCATATTCATGACTATATTGAAAGTCTGCCAGACAAATACGATACTCTGGTAGATGATGACCAGAATATTTTC
TCAACTGGGCAGAAACAGCTGATTTCCATCGCTAGAACTTTGCTGACTGATCCGCAAGTCTTGATTTTGGACGAAGCGAC
TTCCAATGTCGATACGGTGACGGAGAGCAAGATTCAGCAAGCCATGGAAGCCGTTGTGGCTGGCCGAACTAGCTTTGTCA
TTGCTCACCGCCTCAAGACAATTCTCAATGCCGACCAGATTATCGTCCTCAAAGACGGAGAGGTTATCGAACAGGGCGAT
CATCATCAGCTCCTTAAACTCGGCGGTTTCTATTCAGAACTTTATCACAACCAGTTTGTCTTTGAGTAG

Domains


Predicted by InterproScan.

(39-188)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rcrQ Streptococcus mutans UA159

48.649

98.855

0.481