Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   RJD11_RS16585 Genome accession   NZ_CP135184
Coordinates   3261781..3261921 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain NDB     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3256781..3266921
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RJD11_RS16560 (RJD11_16560) - 3257108..3257491 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  RJD11_RS16565 (RJD11_16565) comA 3257513..3258157 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  RJD11_RS16570 (RJD11_16570) comP 3258238..3260544 (-) 2307 WP_015240483.1 sensor histidine kinase Regulator
  RJD11_RS16575 (RJD11_16575) comX 3260563..3260739 (-) 177 WP_015240484.1 competence pheromone ComX -
  RJD11_RS16580 (RJD11_16580) - 3260754..3261629 (-) 876 WP_025285191.1 polyprenyl synthetase family protein -
  RJD11_RS16585 (RJD11_16585) degQ 3261781..3261921 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  RJD11_RS16590 (RJD11_16590) - 3262386..3262727 (+) 342 WP_124692757.1 hypothetical protein -
  RJD11_RS16595 (RJD11_16595) - 3262734..3263957 (-) 1224 WP_315563456.1 EAL and HDOD domain-containing protein -
  RJD11_RS16600 (RJD11_16600) - 3264087..3265553 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  RJD11_RS16605 (RJD11_16605) - 3265571..3266122 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  RJD11_RS16610 (RJD11_16610) - 3266219..3266617 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=886064 RJD11_RS16585 WP_003152043.1 3261781..3261921(-) (degQ) [Bacillus velezensis strain NDB]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=886064 RJD11_RS16585 WP_003152043.1 3261781..3261921(-) (degQ) [Bacillus velezensis strain NDB]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891