Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   RMQ71_RS04475 Genome accession   NZ_CP135172
Coordinates   924181..924666 (+) Length   161 a.a.
NCBI ID   WP_014569470.1    Uniprot ID   -
Organism   Lacticaseibacillus rhamnosus strain DS0508     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 912773..957962 924181..924666 within 0


Gene organization within MGE regions


Location: 912773..957962
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RMQ71_RS04360 (RMQ71_04360) - 912773..913957 (-) 1185 WP_014569455.1 tyrosine-type recombinase/integrase -
  RMQ71_RS04365 (RMQ71_04365) - 914131..914334 (+) 204 WP_016381464.1 hypothetical protein -
  RMQ71_RS04370 (RMQ71_04370) - 914302..915303 (-) 1002 WP_014569456.1 hypothetical protein -
  RMQ71_RS04375 (RMQ71_04375) - 915414..915617 (-) 204 WP_005716134.1 hypothetical protein -
  RMQ71_RS04380 (RMQ71_04380) - 915641..916066 (-) 426 WP_015764910.1 pyridoxamine 5'-phosphate oxidase family protein -
  RMQ71_RS04385 (RMQ71_04385) - 916200..916367 (+) 168 WP_016364973.1 hypothetical protein -
  RMQ71_RS04390 (RMQ71_04390) - 916452..916670 (+) 219 WP_016364974.1 hypothetical protein -
  RMQ71_RS04395 (RMQ71_04395) - 916671..917426 (-) 756 WP_003606998.1 hypothetical protein -
  RMQ71_RS04400 (RMQ71_04400) - 917533..918234 (-) 702 WP_014569458.1 DUF3862 domain-containing protein -
  RMQ71_RS04405 (RMQ71_04405) - 918294..918716 (-) 423 WP_014569459.1 ImmA/IrrE family metallo-endopeptidase -
  RMQ71_RS04410 (RMQ71_04410) - 918706..919041 (-) 336 WP_005714743.1 helix-turn-helix domain-containing protein -
  RMQ71_RS04415 (RMQ71_04415) - 919179..919421 (+) 243 WP_014569460.1 helix-turn-helix transcriptional regulator -
  RMQ71_RS04420 (RMQ71_04420) - 919418..919666 (+) 249 WP_029943629.1 hypothetical protein -
  RMQ71_RS04425 (RMQ71_04425) - 919663..919890 (-) 228 WP_014569461.1 hypothetical protein -
  RMQ71_RS04430 (RMQ71_04430) - 919978..920136 (+) 159 WP_014569462.1 hypothetical protein -
  RMQ71_RS04435 (RMQ71_04435) - 920202..920750 (+) 549 WP_014569463.1 hypothetical protein -
  RMQ71_RS04440 (RMQ71_04440) - 920729..920959 (+) 231 WP_015764912.1 helix-turn-helix domain-containing protein -
  RMQ71_RS04445 (RMQ71_04445) - 920963..921091 (+) 129 WP_014569465.1 hypothetical protein -
  RMQ71_RS04450 (RMQ71_04450) - 921103..921330 (+) 228 WP_014569466.1 hypothetical protein -
  RMQ71_RS04455 (RMQ71_04455) - 921323..921493 (+) 171 WP_015764913.1 hypothetical protein -
  RMQ71_RS04460 (RMQ71_04460) - 921537..922412 (+) 876 WP_014569467.1 recombinase RecT -
  RMQ71_RS04465 (RMQ71_04465) - 922432..923196 (+) 765 WP_014569468.1 PD-(D/E)XK nuclease-like domain-containing protein -
  RMQ71_RS04470 (RMQ71_04470) - 923212..924168 (+) 957 WP_014569469.1 DnaD domain-containing protein -
  RMQ71_RS04475 (RMQ71_04475) ssb 924181..924666 (+) 486 WP_014569470.1 single-stranded DNA-binding protein Machinery gene
  RMQ71_RS04480 (RMQ71_04480) - 924684..924899 (+) 216 WP_014569471.1 helix-turn-helix domain-containing protein -
  RMQ71_RS04485 (RMQ71_04485) - 924896..925087 (+) 192 WP_015764330.1 helix-turn-helix domain-containing protein -
  RMQ71_RS04490 (RMQ71_04490) - 925457..925906 (+) 450 WP_014569472.1 hypothetical protein -
  RMQ71_RS04495 (RMQ71_04495) - 925953..926207 (+) 255 WP_014569473.1 hypothetical protein -
  RMQ71_RS04500 (RMQ71_04500) - 926204..926605 (+) 402 WP_014569474.1 RusA family crossover junction endodeoxyribonuclease -
  RMQ71_RS04505 (RMQ71_04505) - 926618..927082 (+) 465 WP_014569475.1 hypothetical protein -
  RMQ71_RS04510 (RMQ71_04510) - 927094..927279 (+) 186 WP_014569476.1 hypothetical protein -
  RMQ71_RS04515 (RMQ71_04515) - 927276..927782 (+) 507 WP_014569477.1 DUF1642 domain-containing protein -
  RMQ71_RS04520 (RMQ71_04520) - 927772..927951 (+) 180 WP_015764915.1 hypothetical protein -
  RMQ71_RS04525 (RMQ71_04525) - 927938..928141 (+) 204 WP_029943632.1 hypothetical protein -
  RMQ71_RS04530 (RMQ71_04530) - 928131..928562 (+) 432 WP_014569478.1 hypothetical protein -
  RMQ71_RS04535 (RMQ71_04535) - 928559..928921 (+) 363 WP_015764916.1 hypothetical protein -
  RMQ71_RS04540 (RMQ71_04540) - 928918..929157 (+) 240 WP_014569479.1 hypothetical protein -
  RMQ71_RS04545 (RMQ71_04545) - 929236..929466 (+) 231 WP_015764917.1 hypothetical protein -
  RMQ71_RS04550 (RMQ71_04550) - 929684..930112 (+) 429 WP_005711378.1 hypothetical protein -
  RMQ71_RS04555 (RMQ71_04555) - 931140..932288 (+) 1149 WP_014569480.1 GcrA family cell cycle regulator -
  RMQ71_RS04560 (RMQ71_04560) - 932301..932843 (+) 543 WP_014569481.1 NUMOD4 domain-containing protein -
  RMQ71_RS04565 (RMQ71_04565) - 932836..933156 (+) 321 WP_015764918.1 ribonucleoside-diphosphate reductase -
  RMQ71_RS04570 (RMQ71_04570) - 933193..933726 (+) 534 WP_014569483.1 terminase small subunit -
  RMQ71_RS04575 (RMQ71_04575) - 933704..935059 (+) 1356 WP_029943635.1 PBSX family phage terminase large subunit -
  RMQ71_RS04580 (RMQ71_04580) - 935064..936491 (+) 1428 WP_014569485.1 phage portal protein -
  RMQ71_RS04585 (RMQ71_04585) - 936457..937449 (+) 993 WP_014569486.1 minor capsid protein -
  RMQ71_RS04590 (RMQ71_04590) - 937574..938230 (+) 657 WP_014569487.1 DUF4355 domain-containing protein -
  RMQ71_RS04595 (RMQ71_04595) - 938246..939259 (+) 1014 WP_014569488.1 hypothetical protein -
  RMQ71_RS04600 (RMQ71_04600) - 939487..939861 (+) 375 WP_014569489.1 phage head-tail connector protein -
  RMQ71_RS04605 (RMQ71_04605) - 939866..940168 (+) 303 WP_014569490.1 hypothetical protein -
  RMQ71_RS04610 (RMQ71_04610) - 940165..940530 (+) 366 WP_015764920.1 HK97-gp10 family putative phage morphogenesis protein -
  RMQ71_RS04615 (RMQ71_04615) - 940531..940935 (+) 405 WP_014569492.1 DUF3168 domain-containing protein -
  RMQ71_RS04620 (RMQ71_04620) - 940947..941549 (+) 603 WP_014569493.1 phage tail tube protein -
  RMQ71_RS04625 (RMQ71_04625) - 941636..941968 (+) 333 WP_014569494.1 tail assembly chaperone -
  RMQ71_RS04630 (RMQ71_04630) - 942073..942426 (+) 354 WP_015764921.1 hypothetical protein -
  RMQ71_RS04635 (RMQ71_04635) - 942419..945508 (+) 3090 WP_014569496.1 tape measure protein -
  RMQ71_RS04640 (RMQ71_04640) - 945511..947499 (+) 1989 WP_015764922.1 distal tail protein Dit -
  RMQ71_RS04645 (RMQ71_04645) - 947499..950006 (+) 2508 WP_014569498.1 phage tail protein -
  RMQ71_RS04650 (RMQ71_04650) - 950016..950339 (+) 324 WP_005686996.1 hypothetical protein -
  RMQ71_RS04655 (RMQ71_04655) - 950332..950463 (+) 132 WP_014569499.1 XkdX family protein -
  RMQ71_RS04660 (RMQ71_04660) - 950493..950786 (+) 294 WP_014569500.1 hypothetical protein -
  RMQ71_RS04665 (RMQ71_04665) - 950776..951189 (+) 414 WP_014569501.1 phage holin -
  RMQ71_RS04670 (RMQ71_04670) - 951200..952498 (+) 1299 WP_014569502.1 LysM peptidoglycan-binding domain-containing protein -
  RMQ71_RS04675 (RMQ71_04675) - 952696..952770 (+) 75 Protein_888 glucose-6-phosphate isomerase -
  RMQ71_RS04680 (RMQ71_04680) - 953118..953405 (-) 288 WP_005685833.1 putative quinol monooxygenase -
  RMQ71_RS04685 (RMQ71_04685) - 953701..954552 (-) 852 WP_005685835.1 DNA/RNA non-specific endonuclease -
  RMQ71_RS04690 (RMQ71_04690) - 954552..955295 (-) 744 WP_014569504.1 hypothetical protein -
  RMQ71_RS04695 (RMQ71_04695) - 955424..956587 (-) 1164 WP_005713749.1 glycosyltransferase -
  RMQ71_RS04700 (RMQ71_04700) - 957045..957962 (+) 918 WP_014569505.1 Gfo/Idh/MocA family protein -

Sequence

Protein


Download         Length: 161 a.a.        Molecular weight: 17695.37 Da        Isoelectric Point: 5.8947

>NTDB_id=885831 RMQ71_RS04475 WP_014569470.1 924181..924666(+) (ssb) [Lacticaseibacillus rhamnosus strain DS0508]
MLNSVSLTGRLTRDVDLRYTQSGTETGSFTLAVDRKFKSKNGERETDFVNCQIWRKSAENFANFTHKGALVGIEGRIQTR
TYDNAQGQKVFVTEVIVDNFALLESRQASQNNPKSQQTANASAAATTNASQTTPNASRANTTDPFANNGQPIDIQDDDLP
F

Nucleotide


Download         Length: 486 bp        

>NTDB_id=885831 RMQ71_RS04475 WP_014569470.1 924181..924666(+) (ssb) [Lacticaseibacillus rhamnosus strain DS0508]
TTGCTAAACAGTGTCTCACTAACAGGCCGGCTGACAAGAGATGTTGACTTGCGTTACACGCAAAGTGGCACGGAGACAGG
ATCATTCACGCTGGCCGTTGACCGCAAATTCAAGAGCAAAAACGGAGAACGGGAAACTGATTTCGTAAATTGCCAGATCT
GGCGCAAGTCGGCTGAGAACTTTGCAAATTTCACTCATAAGGGTGCACTTGTTGGCATCGAAGGCCGTATTCAAACGCGT
ACGTACGATAACGCGCAAGGACAGAAAGTGTTCGTGACCGAGGTAATCGTTGATAATTTTGCTTTGCTTGAGTCACGACA
GGCGTCTCAGAACAACCCTAAATCACAGCAAACAGCCAATGCATCAGCAGCAGCGACCACGAACGCGAGTCAAACGACTC
CAAATGCTTCACGAGCGAATACCACGGATCCGTTTGCTAATAATGGCCAGCCGATAGACATCCAAGATGATGATTTGCCA
TTCTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-102)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

61.047

100

0.652
  ssbA Bacillus subtilis subsp. subtilis str. 168

47.674

100

0.509