Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | RNZ43_RS15660 | Genome accession | NZ_CP135143 |
| Coordinates | 3129395..3129535 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain L33a | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3124395..3134535
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RNZ43_RS15635 | - | 3124735..3125118 (-) | 384 | WP_007613430.1 | hotdog fold thioesterase | - |
| RNZ43_RS15640 | comA | 3125140..3125784 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| RNZ43_RS15645 | comP | 3125865..3128156 (-) | 2292 | WP_094247540.1 | histidine kinase | Regulator |
| RNZ43_RS15650 | comX | 3128168..3128332 (-) | 165 | WP_007613432.1 | competence pheromone ComX | - |
| RNZ43_RS15655 | - | 3128332..3129243 (-) | 912 | WP_416406408.1 | polyprenyl synthetase family protein | - |
| RNZ43_RS15660 | degQ | 3129395..3129535 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| RNZ43_RS15665 | - | 3130000..3130341 (+) | 342 | WP_416405794.1 | hypothetical protein | - |
| RNZ43_RS15670 | - | 3130348..3131568 (-) | 1221 | WP_003152038.1 | EAL and HDOD domain-containing protein | - |
| RNZ43_RS15675 | - | 3131698..3133164 (-) | 1467 | WP_014305722.1 | nicotinate phosphoribosyltransferase | - |
| RNZ43_RS15680 | - | 3133182..3133733 (-) | 552 | WP_025853916.1 | cysteine hydrolase family protein | - |
| RNZ43_RS15685 | - | 3133830..3134228 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=885615 RNZ43_RS15660 WP_003152043.1 3129395..3129535(-) (degQ) [Bacillus velezensis strain L33a]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=885615 RNZ43_RS15660 WP_003152043.1 3129395..3129535(-) (degQ) [Bacillus velezensis strain L33a]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |