Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | RJW49_RS03635 | Genome accession | NZ_CP134477 |
| Coordinates | 674378..674911 (+) | Length | 177 a.a. |
| NCBI ID | WP_074393667.1 | Uniprot ID | - |
| Organism | Streptococcus suis strain NLS40 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 666860..705499 | 674378..674911 | within | 0 |
Gene organization within MGE regions
Location: 666860..705499
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RJW49_RS03565 (RJW49_03565) | - | 666860..667630 (-) | 771 | WP_050572622.1 | Arm DNA-binding domain-containing protein | - |
| RJW49_RS03570 (RJW49_03570) | - | 667753..668550 (-) | 798 | WP_074412277.1 | hypothetical protein | - |
| RJW49_RS03575 (RJW49_03575) | - | 668560..668943 (-) | 384 | WP_014736119.1 | ImmA/IrrE family metallo-endopeptidase | - |
| RJW49_RS03580 (RJW49_03580) | - | 668956..669303 (-) | 348 | WP_014736118.1 | helix-turn-helix domain-containing protein | - |
| RJW49_RS03585 (RJW49_03585) | - | 669612..669803 (+) | 192 | WP_014736117.1 | hypothetical protein | - |
| RJW49_RS03590 (RJW49_03590) | - | 669814..670314 (+) | 501 | WP_014736116.1 | hypothetical protein | - |
| RJW49_RS03595 (RJW49_03595) | - | 670409..670564 (+) | 156 | WP_153308537.1 | hypothetical protein | - |
| RJW49_RS03600 (RJW49_03600) | - | 670557..670835 (+) | 279 | WP_014736115.1 | hypothetical protein | - |
| RJW49_RS03605 (RJW49_03605) | - | 670878..671195 (+) | 318 | WP_311048084.1 | transcriptional regulator | - |
| RJW49_RS03610 (RJW49_03610) | - | 671397..671957 (+) | 561 | WP_074393665.1 | hypothetical protein | - |
| RJW49_RS03615 (RJW49_03615) | - | 671961..672653 (+) | 693 | WP_014736111.1 | ERF family protein | - |
| RJW49_RS03620 (RJW49_03620) | - | 672657..673679 (+) | 1023 | WP_074393666.1 | DUF1351 domain-containing protein | - |
| RJW49_RS03625 (RJW49_03625) | - | 673679..674212 (+) | 534 | WP_014736109.1 | MazG-like family protein | - |
| RJW49_RS03630 (RJW49_03630) | - | 674212..674388 (+) | 177 | WP_153308538.1 | hypothetical protein | - |
| RJW49_RS03635 (RJW49_03635) | ssb | 674378..674911 (+) | 534 | WP_074393667.1 | single-stranded DNA-binding protein | Machinery gene |
| RJW49_RS03640 (RJW49_03640) | - | 674927..675205 (+) | 279 | WP_074393668.1 | hypothetical protein | - |
| RJW49_RS03645 (RJW49_03645) | - | 675514..675948 (+) | 435 | WP_074393669.1 | helix-turn-helix domain-containing protein | - |
| RJW49_RS03650 (RJW49_03650) | - | 675959..676393 (+) | 435 | WP_014736106.1 | hypothetical protein | - |
| RJW49_RS03655 (RJW49_03655) | - | 676395..677132 (+) | 738 | WP_014736105.1 | hypothetical protein | - |
| RJW49_RS03660 (RJW49_03660) | - | 677153..677557 (+) | 405 | WP_014736104.1 | hypothetical protein | - |
| RJW49_RS03665 (RJW49_03665) | - | 677752..678603 (+) | 852 | WP_074393670.1 | prohibitin family protein | - |
| RJW49_RS03670 (RJW49_03670) | - | 678604..678906 (+) | 303 | WP_014736101.1 | DUF1372 family protein | - |
| RJW49_RS03675 (RJW49_03675) | - | 678907..679137 (+) | 231 | WP_014736100.1 | hypothetical protein | - |
| RJW49_RS03680 (RJW49_03680) | - | 679130..679360 (+) | 231 | WP_024405238.1 | hypothetical protein | - |
| RJW49_RS03685 (RJW49_03685) | - | 679357..679773 (+) | 417 | WP_014736099.1 | hypothetical protein | - |
| RJW49_RS03690 (RJW49_03690) | - | 679760..679945 (+) | 186 | WP_024405239.1 | hypothetical protein | - |
| RJW49_RS03695 (RJW49_03695) | - | 679938..680174 (+) | 237 | WP_014736098.1 | hypothetical protein | - |
| RJW49_RS03700 (RJW49_03700) | - | 680175..680555 (+) | 381 | WP_014736097.1 | hypothetical protein | - |
| RJW49_RS03705 (RJW49_03705) | - | 680624..681295 (+) | 672 | WP_014736096.1 | DUF4417 domain-containing protein | - |
| RJW49_RS03710 (RJW49_03710) | - | 681292..681675 (+) | 384 | WP_014736095.1 | hypothetical protein | - |
| RJW49_RS03715 (RJW49_03715) | tnpA | 681914..682427 (+) | 514 | Protein_685 | IS200/IS605 family transposase | - |
| RJW49_RS03720 (RJW49_03720) | - | 682672..683163 (+) | 492 | WP_014736094.1 | terminase small subunit | - |
| RJW49_RS03725 (RJW49_03725) | - | 683153..684478 (+) | 1326 | WP_014736093.1 | PBSX family phage terminase large subunit | - |
| RJW49_RS03730 (RJW49_03730) | - | 684490..686079 (+) | 1590 | WP_014736092.1 | phage portal protein | - |
| RJW49_RS03735 (RJW49_03735) | - | 686066..686314 (+) | 249 | WP_024405241.1 | hypothetical protein | - |
| RJW49_RS03740 (RJW49_03740) | - | 686317..687468 (+) | 1152 | WP_074412234.1 | phage minor capsid protein | - |
| RJW49_RS03745 (RJW49_03745) | - | 687615..688181 (+) | 567 | WP_014736089.1 | phage scaffolding protein | - |
| RJW49_RS03750 (RJW49_03750) | - | 688200..689078 (+) | 879 | WP_014736088.1 | hypothetical protein | - |
| RJW49_RS03755 (RJW49_03755) | - | 689089..689343 (+) | 255 | WP_014736087.1 | hypothetical protein | - |
| RJW49_RS03760 (RJW49_03760) | - | 689387..689782 (+) | 396 | WP_014736086.1 | hypothetical protein | - |
| RJW49_RS03765 (RJW49_03765) | - | 689772..690098 (+) | 327 | WP_014736085.1 | putative minor capsid protein | - |
| RJW49_RS03770 (RJW49_03770) | - | 690098..690448 (+) | 351 | WP_014736084.1 | minor capsid protein | - |
| RJW49_RS03775 (RJW49_03775) | - | 690448..690855 (+) | 408 | WP_014736083.1 | minor capsid protein | - |
| RJW49_RS03780 (RJW49_03780) | - | 690859..691317 (+) | 459 | WP_014736082.1 | phage tail tube protein | - |
| RJW49_RS03785 (RJW49_03785) | - | 691340..691708 (+) | 369 | WP_074393339.1 | hypothetical protein | - |
| RJW49_RS03790 (RJW49_03790) | - | 691708..692295 (+) | 588 | WP_014736081.1 | Gp15 family bacteriophage protein | - |
| RJW49_RS03795 (RJW49_03795) | - | 692315..692848 (+) | 534 | WP_216092545.1 | hypothetical protein | - |
| RJW49_RS03800 (RJW49_03800) | - | 692867..695677 (+) | 2811 | WP_216093200.1 | hypothetical protein | - |
| RJW49_RS03805 (RJW49_03805) | - | 695674..697176 (+) | 1503 | WP_014736079.1 | distal tail protein Dit | - |
| RJW49_RS03810 (RJW49_03810) | - | 697176..701618 (+) | 4443 | WP_074393337.1 | phage tail spike protein | - |
| RJW49_RS03815 (RJW49_03815) | - | 701631..703685 (+) | 2055 | WP_074393336.1 | DUF859 family phage minor structural protein | - |
| RJW49_RS03820 (RJW49_03820) | - | 703747..704013 (+) | 267 | WP_014736076.1 | hypothetical protein | - |
| RJW49_RS03825 (RJW49_03825) | - | 704026..704481 (+) | 456 | WP_014736075.1 | hypothetical protein | - |
| RJW49_RS03830 (RJW49_03830) | - | 704456..704659 (+) | 204 | WP_014736074.1 | phage holin | - |
| RJW49_RS03835 (RJW49_03835) | - | 704789..705499 (+) | 711 | WP_014736072.1 | CHAP domain-containing protein | - |
Sequence
Protein
Download Length: 177 a.a. Molecular weight: 19628.25 Da Isoelectric Point: 5.7105
>NTDB_id=880210 RJW49_RS03635 WP_074393667.1 674378..674911(+) (ssb) [Streptococcus suis strain NLS40]
MINNVVLVGRLTRDAELRYTPSNVAVATFTLAVNRSFKNEAGEREADFINCVIWRQAAENLANWAKKGSLIGITGNIQTR
HYDNQQGQRVYVTEVIASNFQLLESRNNQSGQQNQSNSFHNGNNSNSGNFQSGNNQGGSQSPFGNQSTPDFSRSNQQSFF
QGQTTNPMDISDDDLPF
MINNVVLVGRLTRDAELRYTPSNVAVATFTLAVNRSFKNEAGEREADFINCVIWRQAAENLANWAKKGSLIGITGNIQTR
HYDNQQGQRVYVTEVIASNFQLLESRNNQSGQQNQSNSFHNGNNSNSGNFQSGNNQGGSQSPFGNQSTPDFSRSNQQSFF
QGQTTNPMDISDDDLPF
Nucleotide
Download Length: 534 bp
>NTDB_id=880210 RJW49_RS03635 WP_074393667.1 674378..674911(+) (ssb) [Streptococcus suis strain NLS40]
ATGATAAATAACGTTGTTTTAGTAGGGCGACTGACTAGAGATGCTGAATTAAGATATACACCATCAAATGTTGCAGTTGC
CACTTTTACCCTTGCAGTAAATCGCTCTTTCAAAAATGAGGCTGGTGAACGTGAGGCAGATTTTATCAATTGTGTAATTT
GGCGACAAGCAGCAGAAAACCTTGCTAATTGGGCTAAGAAAGGCTCATTGATTGGTATTACAGGAAATATCCAAACACGC
CACTATGACAATCAACAAGGGCAGCGCGTGTATGTGACAGAAGTTATTGCAAGTAATTTTCAATTGTTGGAAAGTCGGAA
CAATCAAAGCGGACAGCAGAACCAGAGCAACTCTTTCCATAATGGAAATAACTCAAATAGTGGTAATTTCCAAAGTGGAA
ACAACCAAGGAGGCTCTCAGTCTCCATTTGGAAATCAATCCACACCAGATTTTAGCCGTAGCAACCAACAATCATTTTTC
CAAGGACAAACCACAAATCCTATGGATATTTCCGATGATGATTTACCTTTCTAG
ATGATAAATAACGTTGTTTTAGTAGGGCGACTGACTAGAGATGCTGAATTAAGATATACACCATCAAATGTTGCAGTTGC
CACTTTTACCCTTGCAGTAAATCGCTCTTTCAAAAATGAGGCTGGTGAACGTGAGGCAGATTTTATCAATTGTGTAATTT
GGCGACAAGCAGCAGAAAACCTTGCTAATTGGGCTAAGAAAGGCTCATTGATTGGTATTACAGGAAATATCCAAACACGC
CACTATGACAATCAACAAGGGCAGCGCGTGTATGTGACAGAAGTTATTGCAAGTAATTTTCAATTGTTGGAAAGTCGGAA
CAATCAAAGCGGACAGCAGAACCAGAGCAACTCTTTCCATAATGGAAATAACTCAAATAGTGGTAATTTCCAAAGTGGAA
ACAACCAAGGAGGCTCTCAGTCTCCATTTGGAAATCAATCCACACCAGATTTTAGCCGTAGCAACCAACAATCATTTTTC
CAAGGACAAACCACAAATCCTATGGATATTTCCGATGATGATTTACCTTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.367 |
100 |
0.554 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.802 |
100 |
0.548 |