Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   RJ564_RS00935 Genome accession   NZ_CP134394
Coordinates   197614..197727 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain ICDC15003-50-1     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 192614..202727
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RJ564_RS00910 (RJ564_00910) - 192662..194887 (+) 2226 WP_310957714.1 ATP-dependent Clp protease ATP-binding subunit -
  RJ564_RS00915 (RJ564_00915) panD 194877..195227 (+) 351 WP_180662627.1 aspartate 1-decarboxylase -
  RJ564_RS00920 (RJ564_00920) - 195238..195531 (+) 294 WP_000347919.1 YbaB/EbfC family nucleoid-associated protein -
  RJ564_RS00925 (RJ564_00925) - 195531..196535 (+) 1005 WP_310957715.1 PDZ domain-containing protein -
  RJ564_RS00930 (RJ564_00930) comB6 196543..197598 (+) 1056 WP_310958088.1 P-type conjugative transfer protein TrbL Machinery gene
  RJ564_RS00935 (RJ564_00935) comB7 197614..197727 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  RJ564_RS00940 (RJ564_00940) comB8 197724..198467 (+) 744 WP_001208395.1 virB8 family protein Machinery gene
  RJ564_RS00945 (RJ564_00945) comB9 198467..199450 (+) 984 WP_180662630.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  RJ564_RS00950 (RJ564_00950) comB10 199443..200579 (+) 1137 WP_310957716.1 DNA type IV secretion system protein ComB10 Machinery gene
  RJ564_RS00955 (RJ564_00955) - 200649..202061 (+) 1413 WP_180662633.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=879887 RJ564_RS00935 WP_001217873.1 197614..197727(+) (comB7) [Helicobacter pylori strain ICDC15003-50-1]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=879887 RJ564_RS00935 WP_001217873.1 197614..197727(+) (comB7) [Helicobacter pylori strain ICDC15003-50-1]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1