Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   RGQ10_RS12305 Genome accession   NZ_CP133760
Coordinates   2441781..2441921 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain F37     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2436781..2446921
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RGQ10_RS12280 (RGQ10_12280) - 2437095..2437478 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  RGQ10_RS12285 (RGQ10_12285) comA 2437500..2438144 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  RGQ10_RS12290 (RGQ10_12290) comP 2438225..2440576 (-) 2352 WP_269800792.1 sensor histidine kinase Regulator
  RGQ10_RS12295 (RGQ10_12295) comX 2440554..2440724 (-) 171 WP_032863917.1 competence pheromone ComX -
  RGQ10_RS12300 (RGQ10_12300) - 2440724..2441629 (-) 906 WP_014418764.1 polyprenyl synthetase family protein -
  RGQ10_RS12305 (RGQ10_12305) degQ 2441781..2441921 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  RGQ10_RS12310 (RGQ10_12310) - 2442387..2442728 (+) 342 WP_014418765.1 hypothetical protein -
  RGQ10_RS12315 (RGQ10_12315) - 2442735..2443958 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  RGQ10_RS12320 (RGQ10_12320) - 2444088..2445554 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  RGQ10_RS12325 (RGQ10_12325) - 2445572..2446123 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  RGQ10_RS12330 (RGQ10_12330) - 2446220..2446618 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=876457 RGQ10_RS12305 WP_003152043.1 2441781..2441921(-) (degQ) [Bacillus velezensis strain F37]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=876457 RGQ10_RS12305 WP_003152043.1 2441781..2441921(-) (degQ) [Bacillus velezensis strain F37]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891