Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   RGQ10_RS08935 Genome accession   NZ_CP133760
Coordinates   1826653..1826826 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain F37     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1821653..1831826
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RGQ10_RS08920 (RGQ10_08920) gcvT 1822466..1823566 (-) 1101 WP_014418366.1 glycine cleavage system aminomethyltransferase GcvT -
  RGQ10_RS08925 (RGQ10_08925) - 1823990..1825660 (+) 1671 WP_021494309.1 DEAD/DEAH box helicase -
  RGQ10_RS08930 (RGQ10_08930) - 1825682..1826476 (+) 795 WP_014418368.1 YqhG family protein -
  RGQ10_RS08935 (RGQ10_08935) sinI 1826653..1826826 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  RGQ10_RS08940 (RGQ10_08940) sinR 1826860..1827195 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  RGQ10_RS08945 (RGQ10_08945) tasA 1827243..1828028 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  RGQ10_RS08950 (RGQ10_08950) sipW 1828093..1828677 (-) 585 WP_014418370.1 signal peptidase I SipW -
  RGQ10_RS08955 (RGQ10_08955) tapA 1828649..1829320 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  RGQ10_RS08960 (RGQ10_08960) - 1829579..1829908 (+) 330 WP_014418372.1 DUF3889 domain-containing protein -
  RGQ10_RS08965 (RGQ10_08965) - 1829949..1830128 (-) 180 WP_003153093.1 YqzE family protein -
  RGQ10_RS08970 (RGQ10_08970) comGG 1830185..1830562 (-) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  RGQ10_RS08975 (RGQ10_08975) comGF 1830563..1830958 (-) 396 WP_014721501.1 competence type IV pilus minor pilin ComGF -
  RGQ10_RS08980 (RGQ10_08980) comGE 1830972..1831286 (-) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  RGQ10_RS08985 (RGQ10_08985) comGD 1831270..1831707 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=876435 RGQ10_RS08935 WP_014418369.1 1826653..1826826(+) (sinI) [Bacillus velezensis strain F37]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=876435 RGQ10_RS08935 WP_014418369.1 1826653..1826826(+) (sinI) [Bacillus velezensis strain F37]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719