Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   RGQ10_RS08980 Genome accession   NZ_CP133760
Coordinates   1830972..1831286 (-) Length   104 a.a.
NCBI ID   WP_032863566.1    Uniprot ID   -
Organism   Bacillus velezensis strain F37     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1825972..1836286
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RGQ10_RS08935 (RGQ10_08935) sinI 1826653..1826826 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  RGQ10_RS08940 (RGQ10_08940) sinR 1826860..1827195 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  RGQ10_RS08945 (RGQ10_08945) tasA 1827243..1828028 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  RGQ10_RS08950 (RGQ10_08950) sipW 1828093..1828677 (-) 585 WP_014418370.1 signal peptidase I SipW -
  RGQ10_RS08955 (RGQ10_08955) tapA 1828649..1829320 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  RGQ10_RS08960 (RGQ10_08960) - 1829579..1829908 (+) 330 WP_014418372.1 DUF3889 domain-containing protein -
  RGQ10_RS08965 (RGQ10_08965) - 1829949..1830128 (-) 180 WP_003153093.1 YqzE family protein -
  RGQ10_RS08970 (RGQ10_08970) comGG 1830185..1830562 (-) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  RGQ10_RS08975 (RGQ10_08975) comGF 1830563..1830958 (-) 396 WP_014721501.1 competence type IV pilus minor pilin ComGF -
  RGQ10_RS08980 (RGQ10_08980) comGE 1830972..1831286 (-) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  RGQ10_RS08985 (RGQ10_08985) comGD 1831270..1831707 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  RGQ10_RS08990 (RGQ10_08990) comGC 1831697..1831963 (-) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  RGQ10_RS08995 (RGQ10_08995) comGB 1832010..1833047 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  RGQ10_RS09000 (RGQ10_09000) comGA 1833034..1834104 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  RGQ10_RS09005 (RGQ10_09005) - 1834297..1835247 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11920.92 Da        Isoelectric Point: 5.8321

>NTDB_id=876438 RGQ10_RS08980 WP_032863566.1 1830972..1831286(-) (comGE) [Bacillus velezensis strain F37]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMMTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPDVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=876438 RGQ10_RS08980 WP_032863566.1 1830972..1831286(-) (comGE) [Bacillus velezensis strain F37]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGATGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGATGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

44.348

100

0.49