Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   RFN66_RS18220 Genome accession   NZ_CP133705
Coordinates   3518986..3519126 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus paralicheniformis strain CP47     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3513986..3524126
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RFN66_RS18195 (RFN66_18195) - 3514280..3514669 (-) 390 WP_009329508.1 hotdog fold thioesterase -
  RFN66_RS18200 (RFN66_18200) comA 3514686..3515324 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  RFN66_RS18205 (RFN66_18205) comP 3515411..3517726 (-) 2316 WP_025809738.1 sensor histidine kinase Regulator
  RFN66_RS18210 (RFN66_18210) comX 3517747..3517917 (-) 171 WP_020452790.1 competence pheromone ComX -
  RFN66_RS18215 (RFN66_18215) - 3517889..3518800 (-) 912 WP_020452791.1 polyprenyl synthetase family protein -
  RFN66_RS18220 (RFN66_18220) degQ 3518986..3519126 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  RFN66_RS18225 (RFN66_18225) - 3519645..3519959 (+) 315 WP_031305040.1 hypothetical protein -
  RFN66_RS18230 (RFN66_18230) - 3520002..3521222 (-) 1221 WP_020452793.1 EAL and HDOD domain-containing protein -
  RFN66_RS18235 (RFN66_18235) - 3521399..3522808 (-) 1410 WP_229029889.1 nicotinate phosphoribosyltransferase -
  RFN66_RS18240 (RFN66_18240) - 3522886..3523437 (-) 552 WP_020452795.1 cysteine hydrolase family protein -
  RFN66_RS18245 (RFN66_18245) - 3523623..3524024 (-) 402 WP_025809741.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=875931 RFN66_RS18220 WP_003184860.1 3518986..3519126(-) (degQ) [Bacillus paralicheniformis strain CP47]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=875931 RFN66_RS18220 WP_003184860.1 3518986..3519126(-) (degQ) [Bacillus paralicheniformis strain CP47]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652