Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   RFN66_RS14295 Genome accession   NZ_CP133705
Coordinates   2786964..2787140 (+) Length   58 a.a.
NCBI ID   WP_023855184.1    Uniprot ID   -
Organism   Bacillus paralicheniformis strain CP47     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2781964..2792140
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RFN66_RS14280 (RFN66_14280) gcvT 2782603..2783697 (-) 1095 WP_095291099.1 glycine cleavage system aminomethyltransferase GcvT -
  RFN66_RS14285 (RFN66_14285) - 2784292..2785971 (+) 1680 WP_020452163.1 DEAD/DEAH box helicase -
  RFN66_RS14290 (RFN66_14290) - 2785978..2786772 (+) 795 WP_309539399.1 YqhG family protein -
  RFN66_RS14295 (RFN66_14295) sinI 2786964..2787140 (+) 177 WP_023855184.1 anti-repressor SinI Regulator
  RFN66_RS14300 (RFN66_14300) sinR 2787174..2787509 (+) 336 WP_023855185.1 transcriptional regulator SinR Regulator
  RFN66_RS14305 (RFN66_14305) tasA 2787614..2788408 (-) 795 WP_020452167.1 biofilm matrix protein TasA -
  RFN66_RS14310 (RFN66_14310) sipW 2788481..2789065 (-) 585 WP_065644169.1 signal peptidase I SipW -
  RFN66_RS14315 (RFN66_14315) tapA 2789062..2789790 (-) 729 WP_020452169.1 amyloid fiber anchoring/assembly protein TapA -
  RFN66_RS14320 (RFN66_14320) - 2790068..2790388 (+) 321 WP_023855188.1 YqzG/YhdC family protein -
  RFN66_RS14325 (RFN66_14325) - 2790418..2790600 (-) 183 WP_020452171.1 YqzE family protein -
  RFN66_RS14330 (RFN66_14330) comGG 2790689..2791054 (-) 366 WP_023855189.1 competence type IV pilus minor pilin ComGG -
  RFN66_RS14335 (RFN66_14335) comGF 2791066..2791554 (-) 489 WP_309539400.1 competence type IV pilus minor pilin ComGF -
  RFN66_RS14340 (RFN66_14340) comGE 2791463..2791810 (-) 348 WP_023855191.1 competence type IV pilus minor pilin ComGE -

Sequence


Protein


Download         Length: 58 a.a.        Molecular weight: 6709.46 Da        Isoelectric Point: 4.5938

>NTDB_id=875914 RFN66_RS14295 WP_023855184.1 2786964..2787140(+) (sinI) [Bacillus paralicheniformis strain CP47]
MNKDKNEKEELDEEWTELIKHALEQGISPEDIRIFLNLGEKSSKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=875914 RFN66_RS14295 WP_023855184.1 2786964..2787140(+) (sinI) [Bacillus paralicheniformis strain CP47]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGATATACGTATTTTTCTCAATTTGGGTGAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5