Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   RFN65_RS08545 Genome accession   NZ_CP133703
Coordinates   1657076..1657249 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain CP35     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1652076..1662249
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RFN65_RS08500 (RFN65_08500) comGE 1652428..1652775 (+) 348 WP_063335293.1 ComG operon protein 5 Machinery gene
  RFN65_RS08505 (RFN65_08505) comGF 1652801..1653184 (+) 384 WP_063335292.1 ComG operon protein ComGF Machinery gene
  RFN65_RS08510 (RFN65_08510) comGG 1653185..1653559 (+) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  RFN65_RS08515 (RFN65_08515) spoIITA 1653631..1653810 (+) 180 WP_003230176.1 YqzE family protein -
  RFN65_RS08520 (RFN65_08520) yqzG 1653852..1654178 (-) 327 WP_047183570.1 YqzG/YhdC family protein -
  RFN65_RS08525 (RFN65_08525) tapA 1654448..1655209 (+) 762 WP_063335290.1 amyloid fiber anchoring/assembly protein TapA -
  RFN65_RS08530 (RFN65_08530) sipW 1655193..1655765 (+) 573 WP_080030740.1 signal peptidase I SipW -
  RFN65_RS08535 (RFN65_08535) tasA 1655829..1656614 (+) 786 WP_003230183.1 biofilm matrix protein TasA -
  RFN65_RS08540 (RFN65_08540) sinR 1656707..1657042 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  RFN65_RS08545 (RFN65_08545) sinI 1657076..1657249 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  RFN65_RS08550 (RFN65_08550) yqhG 1657432..1658226 (-) 795 WP_003230200.1 YqhG family protein -
  RFN65_RS08555 (RFN65_08555) hepAA 1658247..1659920 (-) 1674 WP_047182869.1 DEAD/DEAH box helicase -
  RFN65_RS08560 (RFN65_08560) gcvT 1660363..1661451 (+) 1089 WP_015384081.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=875834 RFN65_RS08545 WP_003230187.1 1657076..1657249(-) (sinI) [Bacillus subtilis strain CP35]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=875834 RFN65_RS08545 WP_003230187.1 1657076..1657249(-) (sinI) [Bacillus subtilis strain CP35]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1