Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   RFN65_RS04925 Genome accession   NZ_CP133703
Coordinates   981911..982051 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain CP35     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 976911..987051
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RFN65_RS04895 (RFN65_04895) yueI 977205..977603 (+) 399 WP_309530125.1 YueI family protein -
  RFN65_RS04900 (RFN65_04900) pncA 977700..978251 (+) 552 WP_014477836.1 cysteine hydrolase family protein -
  RFN65_RS04905 (RFN65_04905) pncB 978267..979739 (+) 1473 WP_309530126.1 nicotinate phosphoribosyltransferase -
  RFN65_RS04910 (RFN65_04910) pdeH 979876..981105 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  RFN65_RS04915 (RFN65_04915) - 981081..981449 (-) 369 WP_015483634.1 hypothetical protein -
  RFN65_RS04920 (RFN65_04920) - 981564..981689 (-) 126 WP_154796978.1 hypothetical protein -
  RFN65_RS04925 (RFN65_04925) degQ 981911..982051 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  RFN65_RS04930 (RFN65_04930) - 982236..983096 (+) 861 WP_015483633.1 polyprenyl synthetase family protein -
  RFN65_RS04935 (RFN65_04935) comX 983109..983273 (+) 165 WP_015384519.1 competence pheromone ComX -
  RFN65_RS04940 (RFN65_04940) comP 983285..985585 (+) 2301 WP_309530127.1 histidine kinase Regulator
  RFN65_RS04945 (RFN65_04945) comA 985666..986310 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  RFN65_RS04950 (RFN65_04950) yuxO 986329..986709 (+) 381 WP_015483631.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=875810 RFN65_RS04925 WP_003220708.1 981911..982051(+) (degQ) [Bacillus subtilis strain CP35]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=875810 RFN65_RS04925 WP_003220708.1 981911..982051(+) (degQ) [Bacillus subtilis strain CP35]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1