Detailed information    

insolico Bioinformatically predicted

Overview


Name   comK/comK1   Type   Regulator
Locus tag   RGC89_RS03525 Genome accession   NZ_CP133663
Coordinates   773514..774089 (+) Length   191 a.a.
NCBI ID   WP_001829272.1    Uniprot ID   -
Organism   Staphylococcus epidermidis strain AR4072     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 774490..818213 773514..774089 flank 401


Gene organization within MGE regions


Location: 773514..818213
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RGC89_RS03525 (RGC89_03525) comK/comK1 773514..774089 (+) 576 WP_001829272.1 competence protein ComK Regulator
  RGC89_RS03540 (RGC89_03540) - 774490..775539 (-) 1050 WP_002468743.1 site-specific integrase -
  RGC89_RS03545 (RGC89_03545) - 775650..775847 (+) 198 WP_002497576.1 hypothetical protein -
  RGC89_RS03550 (RGC89_03550) - 775844..776251 (-) 408 WP_002497577.1 TIR domain-containing protein -
  RGC89_RS03555 (RGC89_03555) - 776245..776682 (-) 438 WP_002497578.1 DUF4231 domain-containing protein -
  RGC89_RS03560 (RGC89_03560) - 776794..777450 (-) 657 WP_309478165.1 hypothetical protein -
  RGC89_RS03565 (RGC89_03565) - 777469..777930 (-) 462 WP_309478166.1 ImmA/IrrE family metallo-endopeptidase -
  RGC89_RS03570 (RGC89_03570) - 777943..778266 (-) 324 WP_002485814.1 helix-turn-helix domain-containing protein -
  RGC89_RS03575 (RGC89_03575) - 778432..778680 (+) 249 WP_002485846.1 helix-turn-helix domain-containing protein -
  RGC89_RS03580 (RGC89_03580) - 778698..778838 (+) 141 WP_002485815.1 hypothetical protein -
  RGC89_RS03585 (RGC89_03585) - 778831..779055 (-) 225 WP_032603937.1 hypothetical protein -
  RGC89_RS03590 (RGC89_03590) - 779104..779988 (+) 885 WP_309478167.1 hypothetical protein -
  RGC89_RS03595 (RGC89_03595) - 780001..780495 (+) 495 WP_309478168.1 ORF6C domain-containing protein -
  RGC89_RS03600 (RGC89_03600) - 780531..780764 (+) 234 WP_309478169.1 MW1434 family type I TA system toxin -
  RGC89_RS03605 (RGC89_03605) - 780924..781073 (+) 150 WP_309478170.1 hypothetical protein -
  RGC89_RS03610 (RGC89_03610) - 781120..781296 (+) 177 WP_002456867.1 hypothetical protein -
  RGC89_RS03615 (RGC89_03615) - 781358..781609 (+) 252 WP_309478171.1 hypothetical protein -
  RGC89_RS03620 (RGC89_03620) - 781602..782087 (+) 486 WP_309478172.1 siphovirus Gp157 family protein -
  RGC89_RS03625 (RGC89_03625) - 782088..782864 (+) 777 WP_309478173.1 ATP-binding protein -
  RGC89_RS03630 (RGC89_03630) - 782893..783447 (+) 555 WP_309478174.1 single-stranded DNA-binding protein -
  RGC89_RS03635 (RGC89_03635) - 783459..784133 (+) 675 WP_309478175.1 putative HNHc nuclease -
  RGC89_RS03640 (RGC89_03640) - 784308..784715 (-) 408 WP_309478176.1 hypothetical protein -
  RGC89_RS03645 (RGC89_03645) - 784764..785483 (+) 720 WP_309478177.1 helix-turn-helix domain-containing protein -
  RGC89_RS03650 (RGC89_03650) - 785494..786264 (+) 771 WP_373880478.1 ATP-binding protein -
  RGC89_RS03655 (RGC89_03655) - 786258..786419 (+) 162 WP_309478178.1 hypothetical protein -
  RGC89_RS03660 (RGC89_03660) - 786419..786664 (+) 246 WP_002497109.1 hypothetical protein -
  RGC89_RS03665 (RGC89_03665) - 786674..787090 (+) 417 WP_309478179.1 DUF1064 domain-containing protein -
  RGC89_RS03670 (RGC89_03670) - 787077..787451 (+) 375 WP_002484718.1 hypothetical protein -
  RGC89_RS03675 (RGC89_03675) - 787451..787642 (+) 192 WP_002484773.1 hypothetical protein -
  RGC89_RS03680 (RGC89_03680) - 787643..788002 (+) 360 WP_002484760.1 SA1788 family PVL leukocidin-associated protein -
  RGC89_RS03685 (RGC89_03685) - 787999..788451 (+) 453 WP_002484724.1 DUF3310 domain-containing protein -
  RGC89_RS03690 (RGC89_03690) - 788441..788728 (+) 288 WP_002484753.1 hypothetical protein -
  RGC89_RS03695 (RGC89_03695) - 788744..789424 (+) 681 WP_002504784.1 hypothetical protein -
  RGC89_RS03700 (RGC89_03700) - 789421..789606 (+) 186 WP_002500115.1 hypothetical protein -
  RGC89_RS03705 (RGC89_03705) - 789594..789950 (+) 357 WP_373880479.1 thermonuclease family protein -
  RGC89_RS03710 (RGC89_03710) - 789953..790261 (+) 309 WP_309478180.1 hypothetical protein -
  RGC89_RS03715 (RGC89_03715) - 790262..790546 (+) 285 WP_309478181.1 hypothetical protein -
  RGC89_RS03720 (RGC89_03720) - 790539..790823 (+) 285 WP_309478182.1 hypothetical protein -
  RGC89_RS03725 (RGC89_03725) dut 790824..791246 (+) 423 WP_309478183.1 dUTP diphosphatase -
  RGC89_RS03730 (RGC89_03730) - 791343..791645 (-) 303 WP_002499245.1 DUF4870 domain-containing protein -
  RGC89_RS03735 (RGC89_03735) rinB 791750..791932 (+) 183 WP_002502052.1 transcriptional activator RinB -
  RGC89_RS03740 (RGC89_03740) - 791933..792082 (+) 150 WP_002502053.1 DUF1514 domain-containing protein -
  RGC89_RS03745 (RGC89_03745) - 792099..792545 (+) 447 WP_002502054.1 transcriptional regulator -
  RGC89_RS03750 (RGC89_03750) - 793028..793378 (+) 351 WP_002502055.1 HNH endonuclease -
  RGC89_RS03755 (RGC89_03755) - 793538..794023 (+) 486 WP_002502056.1 phage terminase small subunit P27 family -
  RGC89_RS03760 (RGC89_03760) - 794016..795767 (+) 1752 WP_049404235.1 terminase large subunit -
  RGC89_RS03765 (RGC89_03765) - 795783..795977 (+) 195 WP_002502058.1 hypothetical protein -
  RGC89_RS03770 (RGC89_03770) - 795977..797209 (+) 1233 WP_002502059.1 phage portal protein -
  RGC89_RS03775 (RGC89_03775) - 797199..797756 (+) 558 WP_002497603.1 HK97 family phage prohead protease -
  RGC89_RS03780 (RGC89_03780) - 797798..799123 (+) 1326 WP_002502060.1 phage major capsid protein -
  RGC89_RS03785 (RGC89_03785) - 799142..799483 (+) 342 WP_002502061.1 head-tail connector protein -
  RGC89_RS03790 (RGC89_03790) - 799473..799802 (+) 330 WP_002502062.1 head-tail adaptor protein -
  RGC89_RS03795 (RGC89_03795) - 799937..800203 (+) 267 WP_002502063.1 hypothetical protein -
  RGC89_RS03800 (RGC89_03800) - 800206..800610 (+) 405 WP_002502064.1 hypothetical protein -
  RGC89_RS03805 (RGC89_03805) - 800623..801249 (+) 627 WP_002499234.1 major tail protein -
  RGC89_RS03810 (RGC89_03810) - 801268..801453 (+) 186 WP_049367138.1 hypothetical protein -
  RGC89_RS03815 (RGC89_03815) gpG 801517..801879 (+) 363 WP_049367139.1 phage tail assembly chaperone G -
  RGC89_RS03820 (RGC89_03820) gpGT 801912..802064 (+) 153 WP_002502068.1 phage tail assembly chaperone GT -
  RGC89_RS03825 (RGC89_03825) - 802093..806589 (+) 4497 WP_309478184.1 tape measure protein -
  RGC89_RS03830 (RGC89_03830) - 806591..807424 (+) 834 WP_049367142.1 phage tail domain-containing protein -
  RGC89_RS03835 (RGC89_03835) - 807434..808993 (+) 1560 WP_002502071.1 prophage endopeptidase tail family protein -
  RGC89_RS03840 (RGC89_03840) - 808986..809159 (+) 174 WP_002502072.1 hypothetical protein -
  RGC89_RS03845 (RGC89_03845) - 809175..811037 (+) 1863 WP_002502073.1 M14 family metallopeptidase -
  RGC89_RS03850 (RGC89_03850) - 811037..812251 (+) 1215 WP_002502074.1 BppU family phage baseplate upper protein -
  RGC89_RS03855 (RGC89_03855) - 812256..812879 (+) 624 WP_070673728.1 poly-gamma-glutamate hydrolase family protein -
  RGC89_RS03860 (RGC89_03860) - 812876..813301 (+) 426 WP_002502076.1 hypothetical protein -
  RGC89_RS03865 (RGC89_03865) - 813288..813695 (+) 408 WP_002502077.1 hypothetical protein -
  RGC89_RS03870 (RGC89_03870) - 813853..814251 (+) 399 WP_032606342.1 YxeA family protein -
  RGC89_RS03875 (RGC89_03875) - 814315..814725 (+) 411 WP_002502079.1 phage holin -
  RGC89_RS03880 (RGC89_03880) - 814700..816163 (+) 1464 WP_049367144.1 SH3 domain-containing protein -
  RGC89_RS03885 (RGC89_03885) - 816647..817444 (+) 798 WP_049367145.1 HipA family kinase -
  RGC89_RS03890 (RGC89_03890) - 817446..818213 (+) 768 WP_049367147.1 hypothetical protein -

Sequence


Protein


Download         Length: 191 a.a.        Molecular weight: 22782.87 Da        Isoelectric Point: 9.2887

>NTDB_id=875715 RGC89_RS03525 WP_001829272.1 773514..774089(+) (comK/comK1) [Staphylococcus epidermidis strain AR4072]
MTHLPETIYVIRKGDMVIRPKYDEYQQTNGTEIIRFDQTRKESPFKVQRIIERSCKFYGNNYISKKAETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQEENIWINMHYIENVKELKNRKSKIIFANGDSLTLNVSFHSLWHQYTNAIIYYYMVDKQSRM
KSNNPEQPIDYNQSSLNIFEALSRYSLFEEN

Nucleotide


Download         Length: 576 bp        

>NTDB_id=875715 RGC89_RS03525 WP_001829272.1 773514..774089(+) (comK/comK1) [Staphylococcus epidermidis strain AR4072]
ATGACACATTTACCCGAAACGATTTATGTTATACGAAAAGGTGATATGGTAATACGACCTAAATATGATGAATATCAGCA
AACAAATGGTACTGAAATTATCAGATTTGATCAAACTCGCAAAGAAAGTCCATTTAAAGTACAGAGAATTATCGAAAGAT
CATGTAAATTTTATGGTAATAATTATATTAGTAAAAAAGCAGAAACGAATCGTATTACTGGAATCTCTAGTAAACCACCT
ATTTTACTTACGCCTCTTTTTCCTACTTACTTTTTTCCAACTCACTCAGACCGTCAAGAAGAAAATATATGGATTAATAT
GCATTATATTGAAAATGTTAAAGAACTTAAAAATCGTAAGAGTAAAATAATTTTTGCGAATGGTGATTCGTTAACGCTCA
ATGTATCATTTCATAGCTTGTGGCATCAATATACGAATGCAATCATCTATTATTACATGGTAGATAAGCAATCACGAATG
AAATCTAACAACCCTGAACAACCCATTGACTATAATCAGTCTTCTCTAAATATTTTCGAGGCGCTCTCACGCTACTCCCT
TTTTGAAGAAAATTAG

Domains


Predicted by InterproScan.

(7-158)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

76.757

96.859

0.743

  comK/comK1 Staphylococcus aureus N315

76.757

96.859

0.743