Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   RFN60_RS16040 Genome accession   NZ_CP133653
Coordinates   3093955..3094095 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain CP38     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3088955..3099095
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RFN60_RS16015 (RFN60_16015) yuxO 3089232..3089612 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  RFN60_RS16020 (RFN60_16020) comA 3089631..3090275 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  RFN60_RS16025 (RFN60_16025) comP 3090356..3092668 (-) 2313 WP_041332996.1 sensor histidine kinase Regulator
  RFN60_RS16030 (RFN60_16030) comX 3092684..3092905 (-) 222 WP_014480704.1 competence pheromone ComX -
  RFN60_RS16035 (RFN60_16035) - 3092907..3093770 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  RFN60_RS16040 (RFN60_16040) degQ 3093955..3094095 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  RFN60_RS16045 (RFN60_16045) - 3094317..3094442 (+) 126 WP_003228793.1 hypothetical protein -
  RFN60_RS16050 (RFN60_16050) - 3094557..3094925 (+) 369 WP_046381300.1 hypothetical protein -
  RFN60_RS16055 (RFN60_16055) pdeH 3094901..3096130 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  RFN60_RS16060 (RFN60_16060) pncB 3096267..3097739 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  RFN60_RS16065 (RFN60_16065) pncA 3097755..3098306 (-) 552 WP_038828671.1 cysteine hydrolase family protein -
  RFN60_RS16070 (RFN60_16070) yueI 3098403..3098801 (-) 399 WP_032726794.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=875597 RFN60_RS16040 WP_003220708.1 3093955..3094095(-) (degQ) [Bacillus subtilis strain CP38]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=875597 RFN60_RS16040 WP_003220708.1 3093955..3094095(-) (degQ) [Bacillus subtilis strain CP38]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1