Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   LTWDN19_RS10195 Genome accession   NZ_AP024685
Coordinates   1956834..1957250 (+) Length   138 a.a.
NCBI ID   WP_221276505.1    Uniprot ID   -
Organism   Latilactobacillus curvatus strain WDN19     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1946527..1966380 1956834..1957250 within 0


Gene organization within MGE regions


Location: 1946527..1966380
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LTWDN19_RS10100 (LTWDN19_20170) - 1946527..1947777 (-) 1251 WP_375792402.1 tyrosine-type recombinase/integrase -
  LTWDN19_RS10105 (LTWDN19_20180) - 1947833..1948531 (-) 699 WP_221276488.1 hypothetical protein -
  LTWDN19_RS10110 (LTWDN19_20190) - 1948528..1948905 (-) 378 WP_221276489.1 hypothetical protein -
  LTWDN19_RS10115 (LTWDN19_20200) - 1948910..1949836 (-) 927 WP_221276490.1 ParA family protein -
  LTWDN19_RS10120 (LTWDN19_20210) - 1949932..1950648 (-) 717 WP_221276491.1 hypothetical protein -
  LTWDN19_RS10125 (LTWDN19_20220) - 1950669..1951061 (-) 393 WP_221276492.1 DUF4064 domain-containing protein -
  LTWDN19_RS10130 (LTWDN19_20230) - 1951167..1952012 (-) 846 WP_221276493.1 hypothetical protein -
  LTWDN19_RS10135 (LTWDN19_20240) - 1952073..1952474 (-) 402 WP_221276494.1 ImmA/IrrE family metallo-endopeptidase -
  LTWDN19_RS10140 (LTWDN19_20250) - 1952474..1952809 (-) 336 WP_069468036.1 helix-turn-helix domain-containing protein -
  LTWDN19_RS10145 (LTWDN19_20260) - 1952958..1953185 (+) 228 WP_221276495.1 helix-turn-helix transcriptional regulator -
  LTWDN19_RS10150 (LTWDN19_20270) - 1953208..1953453 (+) 246 WP_221276496.1 hypothetical protein -
  LTWDN19_RS10155 (LTWDN19_20280) - 1953431..1953682 (-) 252 WP_221276497.1 hypothetical protein -
  LTWDN19_RS10160 (LTWDN19_20290) - 1953768..1953932 (+) 165 WP_221276498.1 hypothetical protein -
  LTWDN19_RS10165 (LTWDN19_20300) - 1954013..1954528 (+) 516 WP_221276499.1 hypothetical protein -
  LTWDN19_RS10170 (LTWDN19_20310) - 1954531..1954779 (+) 249 WP_221276500.1 LacI family DNA-binding transcriptional regulator -
  LTWDN19_RS10175 (LTWDN19_20320) - 1954776..1954994 (+) 219 WP_221276501.1 hypothetical protein -
  LTWDN19_RS10180 (LTWDN19_20330) - 1955122..1955304 (+) 183 WP_221276502.1 hypothetical protein -
  LTWDN19_RS10185 (LTWDN19_20340) bet 1955304..1956071 (+) 768 WP_221276503.1 phage recombination protein Bet -
  LTWDN19_RS10190 (LTWDN19_20350) - 1955953..1956822 (+) 870 WP_221276504.1 PD-(D/E)XK nuclease-like domain-containing protein -
  LTWDN19_RS10195 (LTWDN19_20360) ssb 1956834..1957250 (+) 417 WP_221276505.1 single-stranded DNA-binding protein Machinery gene
  LTWDN19_RS10200 (LTWDN19_20370) - 1957261..1958169 (+) 909 WP_221276506.1 DnaD domain-containing protein -
  LTWDN19_RS10205 (LTWDN19_20380) - 1958159..1958368 (+) 210 WP_221276507.1 hypothetical protein -
  LTWDN19_RS10210 (LTWDN19_20390) - 1958369..1958860 (+) 492 WP_221276508.1 hypothetical protein -
  LTWDN19_RS10215 (LTWDN19_20400) - 1958871..1959077 (+) 207 WP_081303843.1 DUF6877 family protein -
  LTWDN19_RS10220 (LTWDN19_20410) - 1959077..1959241 (+) 165 WP_155275678.1 hypothetical protein -
  LTWDN19_RS10225 (LTWDN19_20420) - 1959256..1959432 (+) 177 WP_221276509.1 hypothetical protein -
  LTWDN19_RS10230 (LTWDN19_20430) - 1959553..1960020 (+) 468 WP_221276510.1 DUF1064 domain-containing protein -
  LTWDN19_RS10235 (LTWDN19_20440) - 1960017..1960220 (+) 204 WP_221276511.1 hypothetical protein -
  LTWDN19_RS10240 (LTWDN19_20450) - 1960240..1960422 (+) 183 WP_065825504.1 hypothetical protein -
  LTWDN19_RS10245 (LTWDN19_20460) - 1960422..1960658 (+) 237 WP_039098607.1 helix-turn-helix domain-containing protein -
  LTWDN19_RS10250 (LTWDN19_20470) - 1960772..1961197 (+) 426 WP_065825505.1 ArpU family phage packaging/lysis transcriptional regulator -
  LTWDN19_RS10255 (LTWDN19_20480) - 1961689..1962705 (+) 1017 WP_221276512.1 DUF6731 family protein -
  LTWDN19_RS10260 (LTWDN19_20490) - 1962731..1963213 (+) 483 WP_221276513.1 hypothetical protein -
  LTWDN19_RS10795 (LTWDN19_20500) - 1963312..1963440 (+) 129 WP_260332653.1 hypothetical protein -
  LTWDN19_RS10265 (LTWDN19_20520) - 1963718..1964029 (+) 312 WP_076632024.1 bacteriocin immunity protein -
  LTWDN19_RS10270 (LTWDN19_20530) - 1964098..1964268 (+) 171 WP_164905632.1 hypothetical protein -
  LTWDN19_RS10275 (LTWDN19_20540) - 1964268..1965113 (+) 846 WP_221276514.1 terminase small subunit -
  LTWDN19_RS10280 (LTWDN19_20550) - 1965106..1966380 (+) 1275 WP_221276515.1 PBSX family phage terminase large subunit -

Sequence


Protein


Download         Length: 138 a.a.        Molecular weight: 15194.69 Da        Isoelectric Point: 6.4464

>NTDB_id=87545 LTWDN19_RS10195 WP_221276505.1 1956834..1957250(+) (ssb) [Latilactobacillus curvatus strain WDN19]
MNSVNLIGNLTADIKLETSSNQTHYTRFSLAVRRDANHTDFINCVAFGKTAEMLSNQIKGSKIGVSGSWQTGSYQNQQGQ
KVYTNDCSVYRVYFLSPLNKDADTRNTAPSSAATTNNYVDPFANNGQPIDISDNDLPF

Nucleotide


Download         Length: 417 bp        

>NTDB_id=87545 LTWDN19_RS10195 WP_221276505.1 1956834..1957250(+) (ssb) [Latilactobacillus curvatus strain WDN19]
ATGAATTCAGTAAACTTAATCGGCAACTTAACAGCCGATATTAAATTGGAGACAAGCAGCAATCAAACACACTATACAAG
ATTCTCTTTAGCGGTAAGACGTGATGCTAATCACACGGACTTCATTAACTGTGTTGCGTTTGGAAAGACAGCAGAAATGC
TAAGTAATCAGATAAAAGGTTCAAAGATTGGTGTTAGTGGCAGCTGGCAAACAGGCAGCTATCAAAACCAACAAGGACAA
AAGGTTTATACCAATGATTGTAGCGTTTATCGGGTTTATTTCTTATCGCCGCTAAATAAAGATGCTGACACACGCAATAC
AGCGCCAAGTTCAGCAGCAACAACTAATAACTATGTTGATCCATTCGCAAATAACGGACAACCAATCGATATTTCAGATA
ACGATTTACCGTTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

39.645

100

0.486

  ssbA Bacillus subtilis subsp. subtilis str. 168

36.257

100

0.449


Multiple sequence alignment