Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   RE735_RS04680 Genome accession   NZ_CP133585
Coordinates   914683..914823 (+) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus aerius strain NEB1378     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 909683..919823
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RE735_RS04650 (RE735_04650) - 909686..909934 (+) 249 WP_309174753.1 YueH family protein -
  RE735_RS04655 (RE735_04655) - 909962..910369 (+) 408 WP_309174754.1 YueI family protein -
  RE735_RS04660 (RE735_04660) - 910430..910981 (+) 552 WP_309174755.1 isochorismatase family cysteine hydrolase -
  RE735_RS04665 (RE735_04665) - 910999..912468 (+) 1470 WP_309174756.1 nicotinate phosphoribosyltransferase -
  RE735_RS04670 (RE735_04670) - 912598..913782 (+) 1185 Protein_908 EAL and HDOD domain-containing protein -
  RE735_RS04675 (RE735_04675) - 913824..914177 (-) 354 WP_019744042.1 hypothetical protein -
  RE735_RS04680 (RE735_04680) degQ 914683..914823 (+) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  RE735_RS04685 (RE735_04685) - 914976..915899 (+) 924 WP_309174757.1 polyprenyl synthetase family protein -
  RE735_RS04690 (RE735_04690) comX 915877..916050 (+) 174 WP_309174758.1 competence pheromone ComX -
  RE735_RS04695 (RE735_04695) comP 916064..918355 (+) 2292 WP_309174759.1 ATP-binding protein Regulator
  RE735_RS04700 (RE735_04700) comA 918436..919077 (+) 642 WP_007500477.1 response regulator transcription factor Regulator
  RE735_RS04705 (RE735_04705) - 919101..919490 (+) 390 WP_309174760.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=875096 RE735_RS04680 WP_003213123.1 914683..914823(+) (degQ) [Bacillus aerius strain NEB1378]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=875096 RE735_RS04680 WP_003213123.1 914683..914823(+) (degQ) [Bacillus aerius strain NEB1378]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAGAGCATTGATCAATACGACAAATATGAATATGTGAAGATTTCTTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696