Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   WHL52_RS17225 Genome accession   NZ_CP149576
Coordinates   3252315..3252455 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain DSM 10     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3247315..3257455
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHL52_RS17200 yuxO 3247628..3248008 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  WHL52_RS17205 comA 3248027..3248671 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  WHL52_RS17210 comP 3248752..3251061 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  WHL52_RS17215 comX 3251076..3251243 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  WHL52_RS17220 comQ 3251231..3252130 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  WHL52_RS17225 degQ 3252315..3252455 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  WHL52_RS17230 - 3252677..3252802 (+) 126 WP_003228793.1 hypothetical protein -
  WHL52_RS17235 - 3252916..3253284 (+) 369 WP_003243784.1 hypothetical protein -
  WHL52_RS17240 pdeH 3253260..3254489 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  WHL52_RS17245 pncB 3254626..3256098 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  WHL52_RS17250 pncA 3256114..3256665 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  WHL52_RS17255 yueI 3256762..3257160 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=875008 WHL52_RS17225 WP_003220708.1 3252315..3252455(-) (degQ) [Bacillus subtilis strain DSM 10]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=875008 WHL52_RS17225 WP_003220708.1 3252315..3252455(-) (degQ) [Bacillus subtilis strain DSM 10]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1