Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   RDU00_RS12475 Genome accession   NZ_CP133449
Coordinates   2357128..2357511 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis strain KK195     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2352128..2362511
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RDU00_RS12435 (RDU00_12435) sinI 2353062..2353235 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  RDU00_RS12440 (RDU00_12440) sinR 2353269..2353604 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  RDU00_RS12445 (RDU00_12445) tasA 2353697..2354482 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  RDU00_RS12450 (RDU00_12450) sipW 2354546..2355118 (-) 573 WP_003246088.1 signal peptidase I SipW -
  RDU00_RS12455 (RDU00_12455) tapA 2355102..2355863 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  RDU00_RS12460 (RDU00_12460) yqzG 2356135..2356461 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  RDU00_RS12465 (RDU00_12465) spoIITA 2356503..2356682 (-) 180 WP_003230176.1 YqzE family protein -
  RDU00_RS12470 (RDU00_12470) comGG 2356753..2357127 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  RDU00_RS12475 (RDU00_12475) comGF 2357128..2357511 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  RDU00_RS12480 (RDU00_12480) comGE 2357537..2357884 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  RDU00_RS12485 (RDU00_12485) comGD 2357868..2358299 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  RDU00_RS12490 (RDU00_12490) comGC 2358289..2358585 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  RDU00_RS12495 (RDU00_12495) comGB 2358599..2359636 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  RDU00_RS12500 (RDU00_12500) comGA 2359623..2360693 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  RDU00_RS12505 (RDU00_12505) corA 2361105..2362058 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=874219 RDU00_RS12475 WP_003230168.1 2357128..2357511(-) (comGF) [Bacillus subtilis strain KK195]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=874219 RDU00_RS12475 WP_003230168.1 2357128..2357511(-) (comGF) [Bacillus subtilis strain KK195]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1