Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   RDU00_RS12435 Genome accession   NZ_CP133449
Coordinates   2353062..2353235 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain KK195     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2348062..2358235
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RDU00_RS12420 (RDU00_12420) gcvT 2348861..2349949 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  RDU00_RS12425 (RDU00_12425) hepAA 2350391..2352064 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  RDU00_RS12430 (RDU00_12430) yqhG 2352085..2352879 (+) 795 WP_003230200.1 YqhG family protein -
  RDU00_RS12435 (RDU00_12435) sinI 2353062..2353235 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  RDU00_RS12440 (RDU00_12440) sinR 2353269..2353604 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  RDU00_RS12445 (RDU00_12445) tasA 2353697..2354482 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  RDU00_RS12450 (RDU00_12450) sipW 2354546..2355118 (-) 573 WP_003246088.1 signal peptidase I SipW -
  RDU00_RS12455 (RDU00_12455) tapA 2355102..2355863 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  RDU00_RS12460 (RDU00_12460) yqzG 2356135..2356461 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  RDU00_RS12465 (RDU00_12465) spoIITA 2356503..2356682 (-) 180 WP_003230176.1 YqzE family protein -
  RDU00_RS12470 (RDU00_12470) comGG 2356753..2357127 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  RDU00_RS12475 (RDU00_12475) comGF 2357128..2357511 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  RDU00_RS12480 (RDU00_12480) comGE 2357537..2357884 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=874216 RDU00_RS12435 WP_003230187.1 2353062..2353235(+) (sinI) [Bacillus subtilis strain KK195]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=874216 RDU00_RS12435 WP_003230187.1 2353062..2353235(+) (sinI) [Bacillus subtilis strain KK195]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1