Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   K6J86_RS16955 Genome accession   NZ_AP024627
Coordinates   3229351..3229491 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain BEST3136     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3224351..3234491
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K6J86_RS16930 (BsBEST3136_32630) yuxO 3224628..3225008 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  K6J86_RS16935 (BsBEST3136_32640) comA 3225027..3225671 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  K6J86_RS16940 (BsBEST3136_32650) comP 3225752..3228064 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  K6J86_RS16945 (BsBEST3136_32660) comX 3228080..3228301 (-) 222 WP_014480704.1 competence pheromone ComX -
  K6J86_RS16950 (BsBEST3136_32670) - 3228303..3229166 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  K6J86_RS16955 (BsBEST3136_32680) degQ 3229351..3229491 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  K6J86_RS16960 - 3229713..3229838 (+) 126 WP_003228793.1 hypothetical protein -
  K6J86_RS16965 (BsBEST3136_32690) - 3229952..3230320 (+) 369 WP_014477834.1 hypothetical protein -
  K6J86_RS16970 (BsBEST3136_32700) pdeH 3230296..3231525 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  K6J86_RS16975 (BsBEST3136_32710) pncB 3231661..3233133 (-) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  K6J86_RS16980 (BsBEST3136_32720) pncA 3233149..3233700 (-) 552 WP_014480709.1 cysteine hydrolase family protein -
  K6J86_RS16985 (BsBEST3136_32730) yueI 3233797..3234195 (-) 399 WP_014480710.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=87313 K6J86_RS16955 WP_003220708.1 3229351..3229491(-) (degQ) [Bacillus subtilis strain BEST3136]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=87313 K6J86_RS16955 WP_003220708.1 3229351..3229491(-) (degQ) [Bacillus subtilis strain BEST3136]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment