Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   BsBEST3145_RS13115 Genome accession   NZ_AP024625
Coordinates   2518540..2518713 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain BEST3109     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2513540..2523713
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BsBEST3145_RS13100 (BsBEST3109_25090) gcvT 2514339..2515427 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  BsBEST3145_RS13105 (BsBEST3109_25100) hepAA 2515869..2517542 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  BsBEST3145_RS13110 (BsBEST3109_25110) yqhG 2517563..2518357 (+) 795 WP_003230200.1 YqhG family protein -
  BsBEST3145_RS13115 (BsBEST3109_25120) sinI 2518540..2518713 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BsBEST3145_RS13120 (BsBEST3109_25130) sinR 2518747..2519082 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BsBEST3145_RS13125 (BsBEST3109_25140) tasA 2519175..2519960 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  BsBEST3145_RS13130 (BsBEST3109_25150) sipW 2520024..2520596 (-) 573 WP_003246088.1 signal peptidase I SipW -
  BsBEST3145_RS13135 (BsBEST3109_25160) tapA 2520580..2521341 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  BsBEST3145_RS13140 (BsBEST3109_25170) yqzG 2521613..2521939 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BsBEST3145_RS13145 (BsBEST3109_25180) spoIITA 2521981..2522160 (-) 180 WP_003230176.1 YqzE family protein -
  BsBEST3145_RS13150 (BsBEST3109_25190) comGG 2522231..2522605 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  BsBEST3145_RS13155 (BsBEST3109_25200) comGF 2522606..2522989 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  BsBEST3145_RS13160 (BsBEST3109_25210) comGE 2523015..2523362 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=87120 BsBEST3145_RS13115 WP_003230187.1 2518540..2518713(+) (sinI) [Bacillus subtilis strain BEST3109]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=87120 BsBEST3145_RS13115 WP_003230187.1 2518540..2518713(+) (sinI) [Bacillus subtilis strain BEST3109]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment