Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   K6J99_RS16955 Genome accession   NZ_AP024623
Coordinates   3225736..3225876 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain BEST3102     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3220736..3230876
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K6J99_RS16930 (BsBEST3102_32450) yuxO 3221049..3221429 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  K6J99_RS16935 (BsBEST3102_32460) comA 3221448..3222092 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  K6J99_RS16940 comP 3222173..3224482 (-) 2310 WP_032723438.1 two-component system sensor histidine kinase ComP Regulator
  K6J99_RS16945 (BsBEST3102_32490) comX 3224497..3224664 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  K6J99_RS16950 (BsBEST3102_32500) comQ 3224652..3225551 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  K6J99_RS16955 (BsBEST3102_32510) degQ 3225736..3225876 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  K6J99_RS16960 - 3226098..3226223 (+) 126 WP_003228793.1 hypothetical protein -
  K6J99_RS16965 (BsBEST3102_32520) - 3226337..3226705 (+) 369 WP_003243784.1 hypothetical protein -
  K6J99_RS16970 (BsBEST3102_32530) pdeH 3226681..3227910 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  K6J99_RS16975 (BsBEST3102_32540) pncB 3228047..3229519 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  K6J99_RS16980 (BsBEST3102_32550) pncA 3229535..3230086 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  K6J99_RS16985 (BsBEST3102_32560) yueI 3230183..3230581 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=86974 K6J99_RS16955 WP_003220708.1 3225736..3225876(-) (degQ) [Bacillus subtilis strain BEST3102]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=86974 K6J99_RS16955 WP_003220708.1 3225736..3225876(-) (degQ) [Bacillus subtilis strain BEST3102]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment