Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   RA177_RS14690 Genome accession   NZ_CP132599
Coordinates   2873300..2873440 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus safensis strain PL23A     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2868300..2878440
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RA177_RS14665 (RA177_14680) - 2868566..2868955 (-) 390 WP_024423321.1 hotdog fold thioesterase -
  RA177_RS14670 (RA177_14685) comA 2868979..2869620 (-) 642 WP_024423322.1 response regulator transcription factor Regulator
  RA177_RS14675 (RA177_14690) comP 2869701..2872013 (-) 2313 WP_024423323.1 ATP-binding protein Regulator
  RA177_RS14680 (RA177_14695) comX 2872067..2872237 (-) 171 WP_073207246.1 competence pheromone ComX -
  RA177_RS14685 (RA177_14700) - 2872234..2873148 (-) 915 WP_024423324.1 polyprenyl synthetase family protein -
  RA177_RS14690 (RA177_14705) degQ 2873300..2873440 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  RA177_RS14695 (RA177_14710) - 2873946..2874302 (+) 357 WP_024423325.1 hypothetical protein -
  RA177_RS14700 (RA177_14715) - 2874338..2875564 (-) 1227 WP_024423326.1 EAL and HDOD domain-containing protein -
  RA177_RS14705 (RA177_14720) - 2875702..2877174 (-) 1473 WP_024423327.1 nicotinate phosphoribosyltransferase -
  RA177_RS14710 (RA177_14725) - 2877192..2877743 (-) 552 WP_024423328.1 cysteine hydrolase family protein -
  RA177_RS14715 (RA177_14730) - 2877804..2878211 (-) 408 WP_024423329.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=869607 RA177_RS14690 WP_003213123.1 2873300..2873440(-) (degQ) [Bacillus safensis strain PL23A]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=869607 RA177_RS14690 WP_003213123.1 2873300..2873440(-) (degQ) [Bacillus safensis strain PL23A]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696