Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   K6K01_RS17005 Genome accession   NZ_AP024622
Coordinates   3236304..3236444 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain BEST3096     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3231304..3241444
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K6K01_RS16980 (BsBEST3096_32550) yuxO 3231617..3231997 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  K6K01_RS16985 (BsBEST3096_32560) comA 3232016..3232660 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  K6K01_RS16990 comP 3232741..3235050 (-) 2310 WP_032723438.1 two-component system sensor histidine kinase ComP Regulator
  K6K01_RS16995 (BsBEST3096_32590) comX 3235065..3235232 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  K6K01_RS17000 (BsBEST3096_32600) comQ 3235220..3236119 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  K6K01_RS17005 (BsBEST3096_32610) degQ 3236304..3236444 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  K6K01_RS17010 - 3236666..3236791 (+) 126 WP_003228793.1 hypothetical protein -
  K6K01_RS17015 (BsBEST3096_32620) - 3236905..3237273 (+) 369 WP_003243784.1 hypothetical protein -
  K6K01_RS17020 (BsBEST3096_32630) pdeH 3237249..3238478 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  K6K01_RS17025 (BsBEST3096_32640) pncB 3238615..3240087 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  K6K01_RS17030 (BsBEST3096_32650) pncA 3240103..3240654 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  K6K01_RS17035 (BsBEST3096_32660) yueI 3240751..3241149 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=86888 K6K01_RS17005 WP_003220708.1 3236304..3236444(-) (degQ) [Bacillus subtilis strain BEST3096]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=86888 K6K01_RS17005 WP_003220708.1 3236304..3236444(-) (degQ) [Bacillus subtilis strain BEST3096]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment