Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   K6K01_RS13170 Genome accession   NZ_AP024622
Coordinates   2531612..2531785 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain BEST3096     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2526612..2536785
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K6K01_RS13155 (BsBEST3096_25160) gcvT 2527411..2528499 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  K6K01_RS13160 (BsBEST3096_25170) hepAA 2528941..2530614 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  K6K01_RS13165 (BsBEST3096_25180) yqhG 2530635..2531429 (+) 795 WP_003230200.1 YqhG family protein -
  K6K01_RS13170 (BsBEST3096_25190) sinI 2531612..2531785 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  K6K01_RS13175 (BsBEST3096_25200) sinR 2531819..2532154 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  K6K01_RS13180 (BsBEST3096_25210) tasA 2532247..2533032 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  K6K01_RS13185 (BsBEST3096_25220) sipW 2533096..2533668 (-) 573 WP_003246088.1 signal peptidase I SipW -
  K6K01_RS13190 (BsBEST3096_25230) tapA 2533652..2534413 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  K6K01_RS13195 (BsBEST3096_25240) yqzG 2534685..2535011 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  K6K01_RS13200 (BsBEST3096_25250) spoIITA 2535053..2535232 (-) 180 WP_003230176.1 YqzE family protein -
  K6K01_RS13205 (BsBEST3096_25260) comGG 2535303..2535677 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  K6K01_RS13210 (BsBEST3096_25270) comGF 2535678..2536061 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  K6K01_RS13215 (BsBEST3096_25280) comGE 2536087..2536434 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=86862 K6K01_RS13170 WP_003230187.1 2531612..2531785(+) (sinI) [Bacillus subtilis strain BEST3096]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=86862 K6K01_RS13170 WP_003230187.1 2531612..2531785(+) (sinI) [Bacillus subtilis strain BEST3096]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment