Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   K6J89_RS17065 Genome accession   NZ_AP024621
Coordinates   3238034..3238174 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain BEST3095     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3233034..3243174
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K6J89_RS17040 (BsBEST3095_32540) yuxO 3233347..3233727 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  K6J89_RS17045 (BsBEST3095_32550) comA 3233746..3234390 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  K6J89_RS17050 comP 3234471..3236780 (-) 2310 WP_032723438.1 two-component system sensor histidine kinase ComP Regulator
  K6J89_RS17055 (BsBEST3095_32580) comX 3236795..3236962 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  K6J89_RS17060 (BsBEST3095_32590) comQ 3236950..3237849 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  K6J89_RS17065 (BsBEST3095_32600) degQ 3238034..3238174 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  K6J89_RS17070 - 3238396..3238521 (+) 126 WP_003228793.1 hypothetical protein -
  K6J89_RS17075 (BsBEST3095_32610) - 3238635..3239003 (+) 369 WP_003243784.1 hypothetical protein -
  K6J89_RS17080 (BsBEST3095_32620) pdeH 3238979..3240208 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  K6J89_RS17085 (BsBEST3095_32630) pncB 3240345..3241817 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  K6J89_RS17090 (BsBEST3095_32640) pncA 3241833..3242384 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  K6J89_RS17095 (BsBEST3095_32650) yueI 3242481..3242879 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=86802 K6J89_RS17065 WP_003220708.1 3238034..3238174(-) (degQ) [Bacillus subtilis strain BEST3095]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=86802 K6J89_RS17065 WP_003220708.1 3238034..3238174(-) (degQ) [Bacillus subtilis strain BEST3095]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment