Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   K6J89_RS13230 Genome accession   NZ_AP024621
Coordinates   2535811..2536194 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis strain BEST3095     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2530811..2541194
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K6J89_RS13190 (BsBEST3095_25180) sinI 2531745..2531918 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  K6J89_RS13195 (BsBEST3095_25190) sinR 2531952..2532287 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  K6J89_RS13200 (BsBEST3095_25200) tasA 2532380..2533165 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  K6J89_RS13205 (BsBEST3095_25210) sipW 2533229..2533801 (-) 573 WP_003246088.1 signal peptidase I SipW -
  K6J89_RS13210 (BsBEST3095_25220) tapA 2533785..2534546 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  K6J89_RS13215 (BsBEST3095_25230) yqzG 2534818..2535144 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  K6J89_RS13220 (BsBEST3095_25240) spoIITA 2535186..2535365 (-) 180 WP_003230176.1 YqzE family protein -
  K6J89_RS13225 (BsBEST3095_25250) comGG 2535436..2535810 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  K6J89_RS13230 (BsBEST3095_25260) comGF 2535811..2536194 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  K6J89_RS13235 (BsBEST3095_25270) comGE 2536220..2536567 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  K6J89_RS13240 (BsBEST3095_25280) comGD 2536551..2536982 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  K6J89_RS13245 (BsBEST3095_25290) comGC 2536972..2537268 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  K6J89_RS13250 (BsBEST3095_25300) comGB 2537282..2538319 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  K6J89_RS13255 (BsBEST3095_25310) comGA 2538306..2539376 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  K6J89_RS13260 (BsBEST3095_25320) corA 2539788..2540741 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=86779 K6J89_RS13230 WP_003230168.1 2535811..2536194(-) (comGF) [Bacillus subtilis strain BEST3095]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=86779 K6J89_RS13230 WP_003230168.1 2535811..2536194(-) (comGF) [Bacillus subtilis strain BEST3095]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment