Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   K6J89_RS13190 Genome accession   NZ_AP024621
Coordinates   2531745..2531918 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain BEST3095     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2526745..2536918
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K6J89_RS13175 (BsBEST3095_25150) gcvT 2527544..2528632 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  K6J89_RS13180 (BsBEST3095_25160) hepAA 2529074..2530747 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  K6J89_RS13185 (BsBEST3095_25170) yqhG 2530768..2531562 (+) 795 WP_003230200.1 YqhG family protein -
  K6J89_RS13190 (BsBEST3095_25180) sinI 2531745..2531918 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  K6J89_RS13195 (BsBEST3095_25190) sinR 2531952..2532287 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  K6J89_RS13200 (BsBEST3095_25200) tasA 2532380..2533165 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  K6J89_RS13205 (BsBEST3095_25210) sipW 2533229..2533801 (-) 573 WP_003246088.1 signal peptidase I SipW -
  K6J89_RS13210 (BsBEST3095_25220) tapA 2533785..2534546 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  K6J89_RS13215 (BsBEST3095_25230) yqzG 2534818..2535144 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  K6J89_RS13220 (BsBEST3095_25240) spoIITA 2535186..2535365 (-) 180 WP_003230176.1 YqzE family protein -
  K6J89_RS13225 (BsBEST3095_25250) comGG 2535436..2535810 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  K6J89_RS13230 (BsBEST3095_25260) comGF 2535811..2536194 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  K6J89_RS13235 (BsBEST3095_25270) comGE 2536220..2536567 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=86776 K6J89_RS13190 WP_003230187.1 2531745..2531918(+) (sinI) [Bacillus subtilis strain BEST3095]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=86776 K6J89_RS13190 WP_003230187.1 2531745..2531918(+) (sinI) [Bacillus subtilis strain BEST3095]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment