Detailed information
Bioinformatically predicted
Overview
| Name | pilL | Type | Machinery gene |
| Locus tag | Q7652_RS02700 | Genome accession | NZ_CP131620 |
| Coordinates | 520213..520686 (+) | Length | 157 a.a. |
| NCBI ID | WP_025455782.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain 2020N08-318 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 521232..558789 | 520213..520686 | flank | 546 |
Gene organization within MGE regions
Location: 520213..558789
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q7652_RS02700 (Q7652_02690) | pilL | 520213..520686 (+) | 474 | WP_025455782.1 | PilX family type IV pilin | Machinery gene |
| Q7652_RS02705 (Q7652_02695) | - | 521298..521743 (-) | 446 | Protein_522 | AzlC family ABC transporter permease | - |
| Q7652_RS02710 (Q7652_02700) | dut | 521909..522361 (+) | 453 | WP_003690909.1 | dUTP diphosphatase | - |
| Q7652_RS02715 (Q7652_02705) | dapC | 522439..523626 (+) | 1188 | WP_003690911.1 | succinyldiaminopimelate transaminase | - |
| Q7652_RS02720 (Q7652_02710) | yaaA | 523782..524561 (+) | 780 | WP_003690913.1 | peroxide stress protein YaaA | - |
| Q7652_RS02735 (Q7652_02725) | - | 525092..526288 (+) | 1197 | WP_003704323.1 | integrase arm-type DNA-binding domain-containing protein | - |
| Q7652_RS02740 (Q7652_02730) | - | 526644..526913 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| Q7652_RS02745 (Q7652_02735) | - | 527108..527791 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| Q7652_RS02750 | - | 528105..528338 (-) | 234 | Protein_529 | hypothetical protein | - |
| Q7652_RS02755 (Q7652_02745) | - | 528449..528664 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| Q7652_RS02760 (Q7652_02750) | - | 528716..529207 (-) | 492 | WP_003691537.1 | siphovirus Gp157 family protein | - |
| Q7652_RS02765 (Q7652_02755) | - | 529204..529386 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| Q7652_RS02770 (Q7652_02760) | - | 529526..530212 (-) | 687 | WP_003691532.1 | hypothetical protein | - |
| Q7652_RS02775 (Q7652_02765) | - | 530281..530442 (-) | 162 | WP_003691530.1 | hypothetical protein | - |
| Q7652_RS02780 (Q7652_02770) | - | 530439..530717 (-) | 279 | WP_003691529.1 | hypothetical protein | - |
| Q7652_RS02785 (Q7652_02775) | - | 530870..531202 (-) | 333 | WP_003691528.1 | hypothetical protein | - |
| Q7652_RS02790 (Q7652_02780) | - | 531343..531630 (-) | 288 | WP_115067298.1 | hypothetical protein | - |
| Q7652_RS02795 (Q7652_02785) | - | 531627..532103 (-) | 477 | WP_002255718.1 | hypothetical protein | - |
| Q7652_RS02800 (Q7652_02790) | - | 532136..532336 (-) | 201 | WP_003692842.1 | hypothetical protein | - |
| Q7652_RS02805 (Q7652_02795) | - | 532534..532947 (-) | 414 | WP_003687963.1 | hypothetical protein | - |
| Q7652_RS02810 (Q7652_02800) | - | 532944..533405 (-) | 462 | WP_003687965.1 | helix-turn-helix transcriptional regulator | - |
| Q7652_RS02815 (Q7652_02805) | - | 533422..533859 (-) | 438 | WP_003687967.1 | hypothetical protein | - |
| Q7652_RS02820 (Q7652_02810) | - | 533974..534690 (-) | 717 | WP_003687969.1 | LexA family transcriptional regulator | - |
| Q7652_RS02825 (Q7652_02815) | - | 534759..534995 (+) | 237 | WP_003687971.1 | Cro/CI family transcriptional regulator | - |
| Q7652_RS02830 (Q7652_02820) | - | 535075..535230 (+) | 156 | WP_047923772.1 | hypothetical protein | - |
| Q7652_RS02835 (Q7652_02825) | - | 535207..535395 (-) | 189 | WP_047926457.1 | hypothetical protein | - |
| Q7652_RS02840 (Q7652_02830) | - | 535569..535796 (+) | 228 | WP_003691442.1 | helix-turn-helix domain-containing protein | - |
| Q7652_RS02845 (Q7652_02835) | - | 535793..536803 (+) | 1011 | WP_014580341.1 | helix-turn-helix domain-containing protein | - |
| Q7652_RS02850 (Q7652_02840) | - | 536815..537588 (+) | 774 | WP_172761111.1 | ATP-binding protein | - |
| Q7652_RS02855 (Q7652_02845) | - | 537581..537829 (+) | 249 | WP_106158912.1 | hypothetical protein | - |
| Q7652_RS02860 (Q7652_02850) | - | 537904..538398 (+) | 495 | WP_003691434.1 | DUF3310 domain-containing protein | - |
| Q7652_RS02865 (Q7652_02855) | - | 538781..538930 (+) | 150 | WP_106178740.1 | hypothetical protein | - |
| Q7652_RS02870 (Q7652_02860) | - | 538959..539240 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| Q7652_RS02875 (Q7652_02865) | - | 539231..539668 (+) | 438 | WP_017147288.1 | RusA family crossover junction endodeoxyribonuclease | - |
| Q7652_RS02880 (Q7652_02870) | - | 539661..539966 (+) | 306 | WP_003687981.1 | nuclease domain-containing protein | - |
| Q7652_RS02885 (Q7652_02875) | - | 539963..540346 (+) | 384 | WP_003690918.1 | recombination protein NinB | - |
| Q7652_RS02890 (Q7652_02880) | - | 540337..540855 (+) | 519 | WP_003687984.1 | HNH endonuclease | - |
| Q7652_RS02895 (Q7652_02885) | - | 540920..541342 (+) | 423 | WP_003690919.1 | hypothetical protein | - |
| Q7652_RS02900 (Q7652_02890) | - | 541342..541881 (+) | 540 | WP_003690920.1 | hypothetical protein | - |
| Q7652_RS02905 (Q7652_02895) | - | 541862..543136 (+) | 1275 | WP_014580143.1 | PBSX family phage terminase large subunit | - |
| Q7652_RS02910 (Q7652_02900) | - | 543121..545388 (+) | 2268 | WP_225577699.1 | hypothetical protein | - |
| Q7652_RS02915 (Q7652_02905) | - | 545625..546821 (+) | 1197 | WP_003690925.1 | hypothetical protein | - |
| Q7652_RS02920 (Q7652_02910) | - | 546818..548032 (+) | 1215 | WP_047954539.1 | hypothetical protein | - |
| Q7652_RS02925 (Q7652_02915) | - | 550926..554030 (+) | 3105 | Protein_564 | PLxRFG domain-containing protein | - |
| Q7652_RS02930 (Q7652_02920) | - | 554012..554749 (+) | 738 | WP_003690932.1 | hypothetical protein | - |
| Q7652_RS02935 (Q7652_02925) | - | 554770..556065 (+) | 1296 | WP_003690933.1 | DUF4043 family protein | - |
| Q7652_RS02940 (Q7652_02930) | - | 556120..556593 (+) | 474 | WP_003690936.1 | hypothetical protein | - |
| Q7652_RS02945 (Q7652_02935) | - | 556599..557084 (+) | 486 | WP_003687997.1 | hypothetical protein | - |
| Q7652_RS02950 (Q7652_02940) | - | 557081..557755 (+) | 675 | WP_003687998.1 | hypothetical protein | - |
| Q7652_RS02955 (Q7652_02945) | - | 557758..557907 (+) | 150 | WP_003706419.1 | hypothetical protein | - |
| Q7652_RS02960 (Q7652_02950) | - | 557944..558789 (-) | 846 | WP_003690940.1 | BRO family protein | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17506.38 Da Isoelectric Point: 9.8238
>NTDB_id=862838 Q7652_RS02700 WP_025455782.1 520213..520686(+) (pilL) [Neisseria gonorrhoeae strain 2020N08-318]
MEQKGFTLIEMMIVVTILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQTIKSKLEIFVSGYKM
NPKIAKKYSVSVKFVDAEKPRVYRLVGVPNVGTGYTLSVWMNSVGDGYKCRDAASAKAYKEQLSGDGGCEALSNRKK
MEQKGFTLIEMMIVVTILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQTIKSKLEIFVSGYKM
NPKIAKKYSVSVKFVDAEKPRVYRLVGVPNVGTGYTLSVWMNSVGDGYKCRDAASAKAYKEQLSGDGGCEALSNRKK
Nucleotide
Download Length: 474 bp
>NTDB_id=862838 Q7652_RS02700 WP_025455782.1 520213..520686(+) (pilL) [Neisseria gonorrhoeae strain 2020N08-318]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCACGATACTCGGCATCATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGACCATCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAAAGTTTGTCGATGCGGAAAAACCAAGGGTATACAGGTTGGTCGG
TGTTCCGAACGTGGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCGGCAAAGGCCTATAAAGAGCAGTTGTCCGGAGACGGTGGTTGTGAAGCCTTATCCAACCGTAAGAAATAG
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCACGATACTCGGCATCATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGACCATCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAAAGTTTGTCGATGCGGAAAAACCAAGGGTATACAGGTTGGTCGG
TGTTCCGAACGTGGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCGGCAAAGGCCTATAAAGAGCAGTTGTCCGGAGACGGTGGTTGTGAAGCCTTATCCAACCGTAAGAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilL | Neisseria gonorrhoeae MS11 |
89.172 |
100 |
0.892 |
| pilX | Neisseria meningitidis 8013 |
85.987 |
100 |
0.86 |