Detailed information
Bioinformatically predicted
Overview
| Name | pilL | Type | Machinery gene |
| Locus tag | Q6380_RS02350 | Genome accession | NZ_CP130899 |
| Coordinates | 449881..450354 (+) | Length | 157 a.a. |
| NCBI ID | WP_025455870.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain NJ195417 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 445443..502495 | 449881..450354 | within | 0 |
Gene organization within MGE regions
Location: 445443..502495
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q6380_RS02325 (Q6380_02325) | dnaB | 445443..446849 (+) | 1407 | WP_047917169.1 | replicative DNA helicase | - |
| Q6380_RS02330 (Q6380_02330) | pilH | 447004..447669 (+) | 666 | WP_047918678.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| Q6380_RS02335 (Q6380_02335) | pilV | 447701..448312 (+) | 612 | WP_050169631.1 | type IV pilus modification protein PilV | Machinery gene |
| Q6380_RS02340 (Q6380_02340) | pilJ | 448309..449289 (+) | 981 | WP_010951046.1 | PilW family protein | Machinery gene |
| Q6380_RS02345 (Q6380_02345) | pilK | 449268..449879 (+) | 612 | WP_003687918.1 | PilX N-terminal domain-containing pilus assembly protein | Machinery gene |
| Q6380_RS02350 (Q6380_02350) | pilL | 449881..450354 (+) | 474 | WP_025455870.1 | PilX family type IV pilin | Machinery gene |
| Q6380_RS02355 (Q6380_02355) | - | 450424..450732 (-) | 309 | WP_010951048.1 | AzlD family protein | - |
| Q6380_RS02360 (Q6380_02360) | - | 450729..451436 (-) | 708 | Protein_460 | AzlC family ABC transporter permease | - |
| Q6380_RS02365 (Q6380_02365) | dut | 451602..452054 (+) | 453 | WP_103195211.1 | dUTP diphosphatase | - |
| Q6380_RS02370 (Q6380_02370) | dapC | 452132..453319 (+) | 1188 | WP_047949582.1 | succinyldiaminopimelate transaminase | - |
| Q6380_RS02375 (Q6380_02375) | yaaA | 453630..454409 (+) | 780 | WP_003706583.1 | peroxide stress protein YaaA | - |
| Q6380_RS02390 (Q6380_02390) | - | 454940..456133 (+) | 1194 | WP_010359935.1 | integrase arm-type DNA-binding domain-containing protein | - |
| Q6380_RS02395 (Q6380_02395) | - | 456489..456758 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| Q6380_RS02400 (Q6380_02400) | - | 456953..457636 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| Q6380_RS11735 | - | 457950..458183 (-) | 234 | Protein_467 | hypothetical protein | - |
| Q6380_RS02410 (Q6380_02410) | - | 458294..458509 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| Q6380_RS02415 (Q6380_02415) | - | 458561..459052 (-) | 492 | WP_003691537.1 | siphovirus Gp157 family protein | - |
| Q6380_RS02420 (Q6380_02420) | - | 459049..459231 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| Q6380_RS02425 (Q6380_02425) | - | 459371..460057 (-) | 687 | WP_050159915.1 | phage replication initiation protein, NGO0469 family | - |
| Q6380_RS02430 (Q6380_02430) | - | 460126..460287 (-) | 162 | WP_003693867.1 | hypothetical protein | - |
| Q6380_RS02435 (Q6380_02435) | - | 460284..460562 (-) | 279 | WP_003691529.1 | NGO1622 family putative holin | - |
| Q6380_RS02440 (Q6380_02440) | - | 460715..461047 (-) | 333 | WP_003687946.1 | hypothetical protein | - |
| Q6380_RS02445 (Q6380_02445) | - | 461188..461463 (-) | 276 | WP_103195391.1 | hypothetical protein | - |
| Q6380_RS02450 (Q6380_02450) | - | 461460..461936 (-) | 477 | WP_002255718.1 | hypothetical protein | - |
| Q6380_RS02455 (Q6380_02455) | - | 461969..462169 (-) | 201 | WP_047954343.1 | hypothetical protein | - |
| Q6380_RS02460 (Q6380_02460) | - | 462367..462780 (-) | 414 | WP_003687963.1 | hypothetical protein | - |
| Q6380_RS02465 (Q6380_02465) | - | 462777..463238 (-) | 462 | WP_003687965.1 | helix-turn-helix domain-containing protein | - |
| Q6380_RS02470 (Q6380_02470) | - | 463255..463692 (-) | 438 | WP_003687967.1 | hypothetical protein | - |
| Q6380_RS02475 (Q6380_02475) | - | 463805..464521 (-) | 717 | WP_003687969.1 | LexA family transcriptional regulator | - |
| Q6380_RS02480 (Q6380_02480) | - | 464590..464826 (+) | 237 | WP_003687971.1 | Cro/CI family transcriptional regulator | - |
| Q6380_RS02485 (Q6380_02485) | - | 464906..465061 (+) | 156 | WP_003689578.1 | hypothetical protein | - |
| Q6380_RS02490 (Q6380_02490) | - | 465038..465226 (-) | 189 | WP_003691445.1 | hypothetical protein | - |
| Q6380_RS02495 (Q6380_02495) | - | 465399..465626 (+) | 228 | WP_003698261.1 | helix-turn-helix domain-containing protein | - |
| Q6380_RS02500 (Q6380_02500) | - | 465623..465760 (+) | 138 | WP_010359998.1 | hypothetical protein | - |
| Q6380_RS02505 (Q6380_02505) | - | 466305..466808 (+) | 504 | WP_010360005.1 | hypothetical protein | - |
| Q6380_RS02510 (Q6380_02510) | - | 466805..468166 (+) | 1362 | WP_003689132.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| Q6380_RS02515 (Q6380_02515) | - | 468260..468466 (+) | 207 | WP_154235934.1 | hypothetical protein | - |
| Q6380_RS02520 (Q6380_02520) | - | 468505..468999 (+) | 495 | WP_003691434.1 | DUF3310 domain-containing protein | - |
| Q6380_RS02525 (Q6380_02525) | - | 469176..469325 (+) | 150 | WP_003689110.1 | hypothetical protein | - |
| Q6380_RS02530 (Q6380_02530) | - | 469354..469635 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| Q6380_RS02535 (Q6380_02535) | - | 469626..470006 (+) | 381 | WP_048596749.1 | RusA family crossover junction endodeoxyribonuclease | - |
| Q6380_RS02540 (Q6380_02540) | - | 470023..470151 (-) | 129 | WP_012503747.1 | hypothetical protein | - |
| Q6380_RS02545 (Q6380_02545) | - | 470273..470680 (+) | 408 | WP_103195307.1 | hypothetical protein | - |
| Q6380_RS02550 (Q6380_02550) | - | 470771..471931 (+) | 1161 | WP_047919575.1 | type I restriction endonuclease | - |
| Q6380_RS02555 (Q6380_02555) | - | 472212..473081 (+) | 870 | WP_103195306.1 | BRO family protein | - |
| Q6380_RS02560 (Q6380_02560) | - | 473374..473823 (+) | 450 | WP_003695485.1 | hypothetical protein | - |
| Q6380_RS02565 (Q6380_02565) | terL | 473885..475306 (+) | 1422 | WP_003697216.1 | phage terminase large subunit | - |
| Q6380_RS02570 (Q6380_02570) | - | 475303..477450 (+) | 2148 | WP_003691423.1 | phage portal protein | - |
| Q6380_RS02575 (Q6380_02575) | - | 477518..478675 (+) | 1158 | WP_047918052.1 | HK97 family phage prohead protease | - |
| Q6380_RS02580 (Q6380_02580) | - | 478716..480215 (+) | 1500 | WP_003691419.1 | hypothetical protein | - |
| Q6380_RS02585 (Q6380_02585) | - | 480222..480578 (+) | 357 | WP_003691418.1 | hypothetical protein | - |
| Q6380_RS02590 (Q6380_02590) | - | 480581..481111 (+) | 531 | WP_003689080.1 | head-tail connector protein | - |
| Q6380_RS02595 (Q6380_02595) | - | 481111..481593 (+) | 483 | WP_041421297.1 | HK97 gp10 family phage protein | - |
| Q6380_RS02600 (Q6380_02600) | - | 481590..482018 (+) | 429 | WP_003689076.1 | hypothetical protein | - |
| Q6380_RS02605 (Q6380_02605) | - | 482044..482817 (+) | 774 | WP_003692869.1 | hypothetical protein | - |
| Q6380_RS02610 (Q6380_02610) | - | 482878..483207 (+) | 330 | WP_003692871.1 | hypothetical protein | - |
| Q6380_RS02615 (Q6380_02615) | - | 483219..483485 (+) | 267 | WP_003689070.1 | hypothetical protein | - |
| Q6380_RS02620 (Q6380_02620) | - | 483485..484084 (+) | 600 | WP_003692874.1 | DUF2460 domain-containing protein | - |
| Q6380_RS02625 (Q6380_02625) | - | 484081..484935 (+) | 855 | WP_003698614.1 | DUF2163 domain-containing protein | - |
| Q6380_RS02630 (Q6380_02630) | - | 484937..485368 (+) | 432 | WP_003689064.1 | NlpC/P60 family protein | - |
| Q6380_RS02635 (Q6380_02635) | - | 485396..485674 (-) | 279 | WP_003689062.1 | helix-turn-helix domain-containing protein | - |
| Q6380_RS02640 (Q6380_02640) | - | 485914..490059 (+) | 4146 | WP_125121574.1 | phage tail protein | - |
| Q6380_RS02645 (Q6380_02645) | - | 490171..490476 (+) | 306 | WP_003689058.1 | hypothetical protein | - |
| Q6380_RS02650 (Q6380_02650) | - | 490547..491017 (+) | 471 | WP_003691410.1 | hypothetical protein | - |
| Q6380_RS02655 (Q6380_02655) | - | 491018..491350 (+) | 333 | WP_003691408.1 | hypothetical protein | - |
| Q6380_RS02660 (Q6380_02660) | - | 491478..491711 (-) | 234 | WP_003692884.1 | hypothetical protein | - |
| Q6380_RS02665 (Q6380_02665) | - | 491719..492066 (-) | 348 | WP_003689051.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| Q6380_RS02670 (Q6380_02670) | - | 492066..492302 (-) | 237 | WP_003689049.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| Q6380_RS02675 (Q6380_02675) | - | 492342..492467 (+) | 126 | WP_255294325.1 | hypothetical protein | - |
| Q6380_RS02680 (Q6380_02680) | - | 492509..493048 (+) | 540 | WP_103195302.1 | TIGR02594 family protein | - |
| Q6380_RS02685 (Q6380_02685) | - | 493048..493206 (+) | 159 | WP_003691816.1 | hypothetical protein | - |
| Q6380_RS02690 (Q6380_02690) | - | 493190..493531 (+) | 342 | WP_003696082.1 | hypothetical protein | - |
| Q6380_RS02695 (Q6380_02695) | - | 494208..497252 (+) | 3045 | WP_103195301.1 | tape measure protein | - |
| Q6380_RS02700 (Q6380_02700) | - | 497312..497791 (-) | 480 | WP_002241413.1 | DUF4760 domain-containing protein | - |
| Q6380_RS02705 (Q6380_02705) | - | 498133..499122 (-) | 990 | WP_003689040.1 | site-specific integrase | - |
| Q6380_RS02710 (Q6380_02710) | - | 499382..499570 (-) | 189 | WP_003689039.1 | hypothetical protein | - |
| Q6380_RS02715 (Q6380_02715) | purM | 499811..500845 (+) | 1035 | WP_003692893.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| Q6380_RS02720 (Q6380_02720) | - | 501842..502495 (+) | 654 | WP_162855545.1 | IS1595 family transposase | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17555.36 Da Isoelectric Point: 9.4067
>NTDB_id=862064 Q6380_RS02350 WP_025455870.1 449881..450354(+) (pilL) [Neisseria gonorrhoeae strain NJ195417]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDDNDILKSKLEIFVSGYKM
NPKIAKKYSVSVRFVDAEKPRAYRLVGVPNAGTGYTLSVWMNSVGDGYKCRDATSAQVYLETLSANTGCEAFSNRKK
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDDNDILKSKLEIFVSGYKM
NPKIAKKYSVSVRFVDAEKPRAYRLVGVPNAGTGYTLSVWMNSVGDGYKCRDATSAQVYLETLSANTGCEAFSNRKK
Nucleotide
Download Length: 474 bp
>NTDB_id=862064 Q6380_RS02350 WP_025455870.1 449881..450354(+) (pilL) [Neisseria gonorrhoeae strain NJ195417]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATCATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACGATAATGATATCCTCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAAGGTTTGTCGATGCGGAAAAACCAAGGGCATACAGGTTGGTCGG
TGTTCCGAACGCGGGGACGGGTTATACTTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCA
CTTCTGCCCAGGTCTATTTGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATCATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACGATAATGATATCCTCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAAGGTTTGTCGATGCGGAAAAACCAAGGGCATACAGGTTGGTCGG
TGTTCCGAACGCGGGGACGGGTTATACTTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCA
CTTCTGCCCAGGTCTATTTGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilL | Neisseria gonorrhoeae MS11 |
100 |
100 |
1 |
| pilX | Neisseria meningitidis 8013 |
85.987 |
100 |
0.86 |