Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | Q3V70_RS05565 | Genome accession | NZ_CP130549 |
| Coordinates | 1127564..1128007 (+) | Length | 147 a.a. |
| NCBI ID | WP_001099009.1 | Uniprot ID | A0A0C6EXF8 |
| Organism | Staphylococcus aureus strain SA03-SX | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1115357..1162647 | 1127564..1128007 | within | 0 |
Gene organization within MGE regions
Location: 1115357..1162647
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q3V70_RS05460 | - | 1115357..1116283 (-) | 927 | WP_000757569.1 | glycerophosphodiester phosphodiesterase | - |
| Q3V70_RS05465 | - | 1116522..1116776 (+) | 255 | WP_001049150.1 | YlbG family protein | - |
| Q3V70_RS05470 | - | 1116779..1117168 (-) | 390 | WP_000814565.1 | hypothetical protein | - |
| Q3V70_RS05475 | rsmD | 1117238..1117780 (+) | 543 | WP_001263796.1 | 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD | - |
| Q3V70_RS05480 | coaD | 1117782..1118264 (+) | 483 | WP_000401377.1 | pantetheine-phosphate adenylyltransferase | - |
| Q3V70_RS05485 | - | 1118326..1119465 (-) | 1140 | WP_000843611.1 | nucleotidyltransferase | - |
| Q3V70_RS05490 | - | 1119592..1120149 (+) | 558 | WP_000872158.1 | DUF177 domain-containing protein | - |
| Q3V70_RS05495 | rpmF | 1120229..1120402 (+) | 174 | WP_000290472.1 | 50S ribosomal protein L32 | - |
| Q3V70_RS05500 | - | 1120519..1121904 (-) | 1386 | WP_000861313.1 | recombinase family protein | - |
| Q3V70_RS05505 | - | 1122111..1122791 (-) | 681 | WP_000392109.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| Q3V70_RS05510 | - | 1122827..1123546 (-) | 720 | WP_303263119.1 | XRE family transcriptional regulator | - |
| Q3V70_RS05515 | - | 1123688..1123906 (+) | 219 | WP_001198672.1 | helix-turn-helix transcriptional regulator | - |
| Q3V70_RS05520 | - | 1123922..1124710 (+) | 789 | WP_001148566.1 | phage antirepressor KilAC domain-containing protein | - |
| Q3V70_RS05525 | - | 1124727..1124921 (+) | 195 | WP_000390105.1 | hypothetical protein | - |
| Q3V70_RS05530 | - | 1125125..1125355 (-) | 231 | WP_000395457.1 | hypothetical protein | - |
| Q3V70_RS05535 | - | 1125414..1125542 (+) | 129 | WP_001559112.1 | hypothetical protein | - |
| Q3V70_RS05540 | - | 1125535..1125696 (+) | 162 | WP_000066025.1 | DUF1270 domain-containing protein | - |
| Q3V70_RS05545 | - | 1125785..1126102 (+) | 318 | WP_000829610.1 | hypothetical protein | - |
| Q3V70_RS05550 | - | 1126107..1126367 (+) | 261 | WP_001556704.1 | DUF1108 family protein | - |
| Q3V70_RS05555 | - | 1126380..1126916 (+) | 537 | WP_001004334.1 | host-nuclease inhibitor Gam family protein | - |
| Q3V70_RS05560 | - | 1126917..1127567 (+) | 651 | WP_000840496.1 | ERF family protein | - |
| Q3V70_RS05565 | ssbA | 1127564..1128007 (+) | 444 | WP_001099009.1 | single-stranded DNA-binding protein | Machinery gene |
| Q3V70_RS05570 | - | 1128019..1128693 (+) | 675 | WP_031899480.1 | putative HNHc nuclease | - |
| Q3V70_RS05575 | - | 1128799..1129656 (-) | 858 | WP_000371250.1 | DUF4393 domain-containing protein | - |
| Q3V70_RS05580 | - | 1129721..1130491 (+) | 771 | WP_089520218.1 | conserved phage C-terminal domain-containing protein | - |
| Q3V70_RS05585 | - | 1130501..1131280 (+) | 780 | WP_303263120.1 | ATP-binding protein | - |
| Q3V70_RS05590 | - | 1131274..1131432 (+) | 159 | WP_000256596.1 | hypothetical protein | - |
| Q3V70_RS05595 | - | 1131445..1131666 (+) | 222 | WP_001123684.1 | DUF3269 family protein | - |
| Q3V70_RS05600 | - | 1131676..1132083 (+) | 408 | WP_000401950.1 | RusA family crossover junction endodeoxyribonuclease | - |
| Q3V70_RS05605 | - | 1132083..1132268 (+) | 186 | WP_001187264.1 | DUF3113 family protein | - |
| Q3V70_RS05610 | - | 1132269..1132628 (+) | 360 | WP_000117792.1 | SA1788 family PVL leukocidin-associated protein | - |
| Q3V70_RS05615 | - | 1132628..1132885 (+) | 258 | WP_000022733.1 | DUF3310 domain-containing protein | - |
| Q3V70_RS05620 | - | 1132888..1133088 (+) | 201 | WP_000235381.1 | hypothetical protein | - |
| Q3V70_RS05625 | - | 1133097..1133345 (+) | 249 | WP_015968801.1 | phi PVL orf 51-like protein | - |
| Q3V70_RS05630 | - | 1133359..1133565 (+) | 207 | WP_000693987.1 | hypothetical protein | - |
| Q3V70_RS05635 | - | 1133568..1133969 (+) | 402 | WP_000695759.1 | hypothetical protein | - |
| Q3V70_RS05640 | - | 1133966..1134313 (+) | 348 | WP_303263121.1 | YopX family protein | - |
| Q3V70_RS05645 | - | 1134310..1134618 (+) | 309 | WP_000144708.1 | hypothetical protein | - |
| Q3V70_RS05650 | - | 1134611..1134847 (+) | 237 | WP_001065023.1 | DUF1024 family protein | - |
| Q3V70_RS05655 | - | 1134852..1135394 (+) | 543 | WP_000185654.1 | dUTP diphosphatase | - |
| Q3V70_RS05660 | - | 1135431..1135619 (+) | 189 | WP_162635434.1 | DUF1381 domain-containing protein | - |
| Q3V70_RS05665 | - | 1135594..1135794 (+) | 201 | WP_001125015.1 | hypothetical protein | - |
| Q3V70_RS05670 | - | 1135797..1135970 (+) | 174 | WP_063456300.1 | transcriptional activator RinB | - |
| Q3V70_RS05675 | - | 1135971..1136117 (+) | 147 | WP_000989998.1 | hypothetical protein | - |
| Q3V70_RS05680 | - | 1136141..1136563 (+) | 423 | WP_024936907.1 | RinA family phage transcriptional activator | - |
| Q3V70_RS05685 | - | 1136752..1137192 (+) | 441 | WP_001003272.1 | terminase small subunit | - |
| Q3V70_RS05690 | - | 1137179..1138456 (+) | 1278 | WP_303263125.1 | PBSX family phage terminase large subunit | - |
| Q3V70_RS05695 | - | 1138467..1140002 (+) | 1536 | WP_001668925.1 | phage portal protein | - |
| Q3V70_RS05700 | - | 1140009..1141004 (+) | 996 | WP_001668926.1 | minor capsid protein | - |
| Q3V70_RS05705 | - | 1141077..1141247 (+) | 171 | WP_000072202.1 | hypothetical protein | - |
| Q3V70_RS05710 | - | 1141275..1141368 (+) | 94 | Protein_1117 | hypothetical protein | - |
| Q3V70_RS05715 | - | 1141356..1141976 (+) | 621 | WP_001668927.1 | DUF4355 domain-containing protein | - |
| Q3V70_RS05720 | - | 1141990..1142964 (+) | 975 | WP_000438502.1 | phage major capsid protein | - |
| Q3V70_RS05725 | - | 1142986..1143273 (+) | 288 | WP_001668928.1 | hypothetical protein | - |
| Q3V70_RS05730 | - | 1143282..1143614 (+) | 333 | WP_000208960.1 | phage head-tail connector protein | - |
| Q3V70_RS05735 | - | 1143611..1143913 (+) | 303 | WP_001268312.1 | hypothetical protein | - |
| Q3V70_RS05740 | - | 1143913..1144260 (+) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| Q3V70_RS05745 | - | 1144272..1144655 (+) | 384 | WP_000188649.1 | hypothetical protein | - |
| Q3V70_RS05750 | - | 1144674..1145249 (+) | 576 | WP_001644672.1 | phage major tail protein, TP901-1 family | - |
| Q3V70_RS05755 | - | 1145311..1145676 (+) | 366 | WP_001100161.1 | tail assembly chaperone | - |
| Q3V70_RS05760 | - | 1145706..1146050 (+) | 345 | WP_000105584.1 | hypothetical protein | - |
| Q3V70_RS05765 | - | 1146067..1149531 (+) | 3465 | WP_303263128.1 | hypothetical protein | - |
| Q3V70_RS05770 | - | 1149544..1150491 (+) | 948 | WP_000350680.1 | phage tail family protein | - |
| Q3V70_RS05775 | - | 1150500..1152401 (+) | 1902 | WP_000156406.1 | SGNH/GDSL hydrolase family protein | - |
| Q3V70_RS05780 | - | 1152416..1154326 (+) | 1911 | WP_053037299.1 | hypothetical protein | - |
| Q3V70_RS05785 | - | 1154326..1156149 (+) | 1824 | WP_000634521.1 | phage baseplate upper protein | - |
| Q3V70_RS05790 | - | 1156149..1156526 (+) | 378 | WP_000705893.1 | DUF2977 domain-containing protein | - |
| Q3V70_RS05795 | - | 1156530..1156703 (+) | 174 | WP_001790193.1 | XkdX family protein | - |
| Q3V70_RS05800 | - | 1156744..1157043 (+) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| Q3V70_RS05805 | - | 1157180..1159078 (+) | 1899 | WP_001835902.1 | glucosaminidase domain-containing protein | - |
| Q3V70_RS05810 | - | 1159091..1160329 (+) | 1239 | WP_303263129.1 | BppU family phage baseplate upper protein | - |
| Q3V70_RS05815 | - | 1160334..1160729 (+) | 396 | WP_000387943.1 | hypothetical protein | - |
| Q3V70_RS05820 | - | 1160784..1161221 (+) | 438 | WP_000354128.1 | phage holin | - |
| Q3V70_RS05825 | - | 1161202..1162647 (+) | 1446 | WP_001148121.1 | SH3 domain-containing protein | - |
Sequence
Protein
Download Length: 147 a.a. Molecular weight: 16321.89 Da Isoelectric Point: 5.8347
>NTDB_id=860214 Q3V70_RS05565 WP_001099009.1 1127564..1128007(+) (ssbA) [Staphylococcus aureus strain SA03-SX]
MNTVNLIGNLVADPELKGQNNNVVNFVIAVQRPFKNKQTNEYETDFIRCVAFGKTAEIIANNFNKGNKIGVTGSIQTGSY
ENNQGQKVFTTDIAVNNITFVERKNNGQSNNQQQHNSYNAPQNRQQSNNPFANANGPIEISDDDLPF
MNTVNLIGNLVADPELKGQNNNVVNFVIAVQRPFKNKQTNEYETDFIRCVAFGKTAEIIANNFNKGNKIGVTGSIQTGSY
ENNQGQKVFTTDIAVNNITFVERKNNGQSNNQQQHNSYNAPQNRQQSNNPFANANGPIEISDDDLPF
Nucleotide
Download Length: 444 bp
>NTDB_id=860214 Q3V70_RS05565 WP_001099009.1 1127564..1128007(+) (ssbA) [Staphylococcus aureus strain SA03-SX]
ATGAATACAGTAAATTTAATTGGGAACCTAGTGGCAGATCCAGAGTTAAAAGGTCAAAACAACAACGTAGTTAACTTTGT
AATCGCAGTACAGAGACCATTCAAAAACAAACAAACTAACGAATATGAAACAGACTTCATTCGTTGTGTTGCATTTGGTA
AGACTGCTGAAATCATCGCTAATAACTTTAATAAAGGTAATAAAATTGGCGTTACTGGTTCAATACAAACCGGTAGTTAT
GAAAATAATCAAGGACAGAAAGTGTTTACTACAGACATCGCAGTCAACAATATAACTTTCGTTGAACGTAAAAACAACGG
TCAATCTAACAACCAACAACAGCATAATTCATATAACGCACCACAGAATAGACAGCAATCAAATAATCCATTTGCTAATG
CTAATGGTCCTATAGAAATCTCTGACGATGATTTACCTTTCTAG
ATGAATACAGTAAATTTAATTGGGAACCTAGTGGCAGATCCAGAGTTAAAAGGTCAAAACAACAACGTAGTTAACTTTGT
AATCGCAGTACAGAGACCATTCAAAAACAAACAAACTAACGAATATGAAACAGACTTCATTCGTTGTGTTGCATTTGGTA
AGACTGCTGAAATCATCGCTAATAACTTTAATAAAGGTAATAAAATTGGCGTTACTGGTTCAATACAAACCGGTAGTTAT
GAAAATAATCAAGGACAGAAAGTGTTTACTACAGACATCGCAGTCAACAATATAACTTTCGTTGAACGTAAAAACAACGG
TCAATCTAACAACCAACAACAGCATAATTCATATAACGCACCACAGAATAGACAGCAATCAAATAATCCATTTGCTAATG
CTAATGGTCCTATAGAAATCTCTGACGATGATTTACCTTTCTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
41.279 |
100 |
0.483 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
38.235 |
100 |
0.442 |