Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   WBM82_RS17080 Genome accession   NZ_CP147494
Coordinates   3200610..3200750 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain YT1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3195610..3205750
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WBM82_RS17055 (WBM82_17105) yuxO 3195952..3196332 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  WBM82_RS17060 (WBM82_17110) comA 3196351..3196995 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  WBM82_RS17065 (WBM82_17115) comP 3197076..3199376 (-) 2301 WP_088300729.1 histidine kinase Regulator
  WBM82_RS17070 (WBM82_17120) comX 3199388..3199552 (-) 165 WP_015384519.1 competence pheromone ComX -
  WBM82_RS17075 (WBM82_17125) comQ 3199565..3200425 (-) 861 WP_128422373.1 polyprenyl synthetase family protein Regulator
  WBM82_RS17080 (WBM82_17130) degQ 3200610..3200750 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  WBM82_RS17085 (WBM82_17135) - 3200972..3201097 (+) 126 WP_141770195.1 hypothetical protein -
  WBM82_RS17090 (WBM82_17140) - 3201212..3201580 (+) 369 WP_014477834.1 hypothetical protein -
  WBM82_RS17095 (WBM82_17145) pdeH 3201556..3202785 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  WBM82_RS17100 (WBM82_17150) pncB 3202922..3204394 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  WBM82_RS17105 (WBM82_17155) pncA 3204410..3204961 (-) 552 WP_038828671.1 isochorismatase family cysteine hydrolase -
  WBM82_RS17110 (WBM82_17160) yueI 3205058..3205456 (-) 399 WP_032726794.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=859574 WBM82_RS17080 WP_003220708.1 3200610..3200750(-) (degQ) [Bacillus subtilis strain YT1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=859574 WBM82_RS17080 WP_003220708.1 3200610..3200750(-) (degQ) [Bacillus subtilis strain YT1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1