Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   Q3O39_RS07810 Genome accession   NZ_CP130475
Coordinates   1492656..1493033 (+) Length   125 a.a.
NCBI ID   WP_032874019.1    Uniprot ID   -
Organism   Bacillus velezensis strain SRCM126726     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1487656..1498033
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q3O39_RS07775 (Q3O39_07775) - 1487967..1488917 (+) 951 WP_032874012.1 magnesium transporter CorA family protein -
  Q3O39_RS07780 (Q3O39_07780) comGA 1489114..1490184 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  Q3O39_RS07785 (Q3O39_07785) comGB 1490171..1491208 (+) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  Q3O39_RS07790 (Q3O39_07790) comGC 1491255..1491521 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  Q3O39_RS07795 (Q3O39_07795) comGD 1491511..1491948 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  Q3O39_RS07800 (Q3O39_07800) comGE 1491932..1492246 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  Q3O39_RS07805 (Q3O39_07805) comGF 1492191..1492655 (+) 465 WP_223813077.1 competence type IV pilus minor pilin ComGF -
  Q3O39_RS07810 (Q3O39_07810) comGG 1492656..1493033 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  Q3O39_RS07815 (Q3O39_07815) - 1493090..1493269 (+) 180 WP_022552966.1 YqzE family protein -
  Q3O39_RS07820 (Q3O39_07820) - 1493310..1493639 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  Q3O39_RS07825 (Q3O39_07825) tapA 1493898..1494569 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  Q3O39_RS07830 (Q3O39_07830) sipW 1494541..1495125 (+) 585 WP_032874025.1 signal peptidase I SipW -
  Q3O39_RS07835 (Q3O39_07835) tasA 1495190..1495975 (+) 786 WP_032874027.1 biofilm matrix protein TasA -
  Q3O39_RS07840 (Q3O39_07840) sinR 1496023..1496358 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  Q3O39_RS07845 (Q3O39_07845) sinI 1496392..1496565 (-) 174 WP_032874029.1 anti-repressor SinI Regulator
  Q3O39_RS07850 (Q3O39_07850) - 1496742..1497536 (-) 795 WP_007612541.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14077.01 Da        Isoelectric Point: 10.2236

>NTDB_id=858458 Q3O39_RS07810 WP_032874019.1 1492656..1493033(+) (comGG) [Bacillus velezensis strain SRCM126726]
MSKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHISGSDRRETVQVTIQTETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=858458 Q3O39_RS07810 WP_032874019.1 1492656..1493033(+) (comGG) [Bacillus velezensis strain SRCM126726]
ATGTCCAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCTCCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGACGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488