Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   Q3B96_RS13315 Genome accession   NZ_CP130465
Coordinates   2596835..2596975 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus licheniformis strain MGMM9     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2591835..2601975
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q3B96_RS13290 (Q3B96_13290) - 2592132..2592521 (-) 390 WP_003184847.1 hotdog fold thioesterase -
  Q3B96_RS13295 (Q3B96_13295) comA 2592538..2593176 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  Q3B96_RS13300 (Q3B96_13300) comP 2593263..2595569 (-) 2307 WP_003184851.1 ATP-binding protein Regulator
  Q3B96_RS13305 (Q3B96_13305) comX 2595592..2595756 (-) 165 WP_003184853.1 competence pheromone ComX -
  Q3B96_RS13310 (Q3B96_13310) - 2595765..2596646 (-) 882 WP_021837675.1 polyprenyl synthetase family protein -
  Q3B96_RS13315 (Q3B96_13315) degQ 2596835..2596975 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  Q3B96_RS13320 (Q3B96_13320) - 2597461..2597808 (+) 348 WP_231105863.1 SDR family oxidoreductase -
  Q3B96_RS13325 (Q3B96_13325) - 2597851..2599071 (-) 1221 WP_003184864.1 EAL and HDOD domain-containing protein -
  Q3B96_RS13330 (Q3B96_13330) - 2599250..2600659 (-) 1410 WP_228767691.1 nicotinate phosphoribosyltransferase -
  Q3B96_RS13335 (Q3B96_13335) - 2600737..2601288 (-) 552 WP_003184868.1 cysteine hydrolase family protein -
  Q3B96_RS13340 (Q3B96_13340) - 2601473..2601874 (-) 402 WP_003184870.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=858367 Q3B96_RS13315 WP_003184860.1 2596835..2596975(-) (degQ) [Bacillus licheniformis strain MGMM9]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=858367 Q3B96_RS13315 WP_003184860.1 2596835..2596975(-) (degQ) [Bacillus licheniformis strain MGMM9]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652