Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   Q3B96_RS02305 Genome accession   NZ_CP130465
Coordinates   400630..400806 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus licheniformis strain MGMM9     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 395630..405806
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q3B96_RS02290 (Q3B96_02290) gcvT 396272..397366 (-) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -
  Q3B96_RS02295 (Q3B96_02295) - 397959..399638 (+) 1680 WP_003183439.1 DEAD/DEAH box helicase -
  Q3B96_RS02300 (Q3B96_02300) - 399645..400439 (+) 795 WP_003183441.1 YqhG family protein -
  Q3B96_RS02305 (Q3B96_02305) sinI 400630..400806 (+) 177 WP_003183444.1 anti-repressor SinI Regulator
  Q3B96_RS02310 (Q3B96_02310) sinR 400840..401175 (+) 336 WP_025804940.1 transcriptional regulator SinR Regulator
  Q3B96_RS02315 (Q3B96_02315) tasA 401280..402074 (-) 795 WP_003183447.1 biofilm matrix protein TasA -
  Q3B96_RS02320 (Q3B96_02320) sipW 402148..402732 (-) 585 WP_003183449.1 signal peptidase I SipW -
  Q3B96_RS02325 (Q3B96_02325) tapA 402729..403457 (-) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  Q3B96_RS02330 (Q3B96_02330) - 403767..404054 (+) 288 WP_223307118.1 YqzG/YhdC family protein -
  Q3B96_RS02335 (Q3B96_02335) - 404078..404260 (-) 183 WP_003183456.1 YqzE family protein -
  Q3B96_RS02340 (Q3B96_02340) comGG 404349..404714 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  Q3B96_RS02345 (Q3B96_02345) comGF 404727..405215 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  Q3B96_RS02350 (Q3B96_02350) comGE 405124..405471 (-) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=858324 Q3B96_RS02305 WP_003183444.1 400630..400806(+) (sinI) [Bacillus licheniformis strain MGMM9]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=858324 Q3B96_RS02305 WP_003183444.1 400630..400806(+) (sinI) [Bacillus licheniformis strain MGMM9]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517