Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   Q3O83_RS11930 Genome accession   NZ_CP130445
Coordinates   2471545..2471922 (-) Length   125 a.a.
NCBI ID   WP_003153092.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain C6.7     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2466545..2476922
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q3O83_RS11890 (Q3O83_11890) - 2467044..2467838 (+) 795 WP_069473503.1 YqhG family protein -
  Q3O83_RS11895 (Q3O83_11895) sinI 2468015..2468188 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  Q3O83_RS11900 (Q3O83_11900) sinR 2468222..2468557 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  Q3O83_RS11905 (Q3O83_11905) tasA 2468605..2469390 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  Q3O83_RS11910 (Q3O83_11910) sipW 2469454..2470038 (-) 585 WP_003153100.1 signal peptidase I SipW -
  Q3O83_RS11915 (Q3O83_11915) tapA 2470010..2470681 (-) 672 WP_046341384.1 amyloid fiber anchoring/assembly protein TapA -
  Q3O83_RS11920 (Q3O83_11920) - 2470940..2471269 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  Q3O83_RS11925 (Q3O83_11925) - 2471309..2471488 (-) 180 WP_003153093.1 YqzE family protein -
  Q3O83_RS11930 (Q3O83_11930) comGG 2471545..2471922 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  Q3O83_RS11935 (Q3O83_11935) comGF 2471923..2472318 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  Q3O83_RS11940 (Q3O83_11940) comGE 2472332..2472646 (-) 315 WP_046341385.1 competence type IV pilus minor pilin ComGE -
  Q3O83_RS11945 (Q3O83_11945) comGD 2472630..2473067 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene
  Q3O83_RS11950 (Q3O83_11950) comGC 2473057..2473365 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  Q3O83_RS11955 (Q3O83_11955) comGB 2473370..2474407 (-) 1038 WP_003153086.1 competence type IV pilus assembly protein ComGB Machinery gene
  Q3O83_RS11960 (Q3O83_11960) comGA 2474394..2475464 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  Q3O83_RS11965 (Q3O83_11965) - 2475656..2476606 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14169.15 Da        Isoelectric Point: 10.1579

>NTDB_id=858214 Q3O83_RS11930 WP_003153092.1 2471545..2471922(-) (comGG) [Bacillus amyloliquefaciens strain C6.7]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSNRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=858214 Q3O83_RS11930 WP_003153092.1 2471545..2471922(-) (comGG) [Bacillus amyloliquefaciens strain C6.7]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTAATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512