Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   Q3O83_RS11895 Genome accession   NZ_CP130445
Coordinates   2468015..2468188 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain C6.7     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2463015..2473188
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q3O83_RS11880 (Q3O83_11880) gcvT 2463833..2464933 (-) 1101 WP_069473502.1 glycine cleavage system aminomethyltransferase GcvT -
  Q3O83_RS11885 (Q3O83_11885) - 2465356..2467026 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  Q3O83_RS11890 (Q3O83_11890) - 2467044..2467838 (+) 795 WP_069473503.1 YqhG family protein -
  Q3O83_RS11895 (Q3O83_11895) sinI 2468015..2468188 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  Q3O83_RS11900 (Q3O83_11900) sinR 2468222..2468557 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  Q3O83_RS11905 (Q3O83_11905) tasA 2468605..2469390 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  Q3O83_RS11910 (Q3O83_11910) sipW 2469454..2470038 (-) 585 WP_003153100.1 signal peptidase I SipW -
  Q3O83_RS11915 (Q3O83_11915) tapA 2470010..2470681 (-) 672 WP_046341384.1 amyloid fiber anchoring/assembly protein TapA -
  Q3O83_RS11920 (Q3O83_11920) - 2470940..2471269 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  Q3O83_RS11925 (Q3O83_11925) - 2471309..2471488 (-) 180 WP_003153093.1 YqzE family protein -
  Q3O83_RS11930 (Q3O83_11930) comGG 2471545..2471922 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  Q3O83_RS11935 (Q3O83_11935) comGF 2471923..2472318 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  Q3O83_RS11940 (Q3O83_11940) comGE 2472332..2472646 (-) 315 WP_046341385.1 competence type IV pilus minor pilin ComGE -
  Q3O83_RS11945 (Q3O83_11945) comGD 2472630..2473067 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=858212 Q3O83_RS11895 WP_003153105.1 2468015..2468188(+) (sinI) [Bacillus amyloliquefaciens strain C6.7]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=858212 Q3O83_RS11895 WP_003153105.1 2468015..2468188(+) (sinI) [Bacillus amyloliquefaciens strain C6.7]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702