Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   Q3O83_RS01950 Genome accession   NZ_CP130445
Coordinates   380664..380783 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus amyloliquefaciens strain C6.7     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 375664..385783
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q3O83_RS01935 (Q3O83_01935) - 377276..377959 (+) 684 WP_103695313.1 response regulator transcription factor -
  Q3O83_RS01940 (Q3O83_01940) - 377946..379379 (+) 1434 WP_161503399.1 HAMP domain-containing sensor histidine kinase -
  Q3O83_RS01945 (Q3O83_01945) rapC 379532..380680 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  Q3O83_RS01950 (Q3O83_01950) phrC 380664..380783 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  Q3O83_RS01955 (Q3O83_01955) - 380933..381028 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  Q3O83_RS01960 (Q3O83_01960) - 381123..382487 (-) 1365 WP_014304341.1 aspartate kinase -
  Q3O83_RS01965 (Q3O83_01965) ceuB 382902..383855 (+) 954 WP_046559346.1 ABC transporter permease Machinery gene
  Q3O83_RS01970 (Q3O83_01970) - 383845..384792 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  Q3O83_RS01975 (Q3O83_01975) - 384786..385544 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=858182 Q3O83_RS01950 WP_003156334.1 380664..380783(+) (phrC) [Bacillus amyloliquefaciens strain C6.7]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=858182 Q3O83_RS01950 WP_003156334.1 380664..380783(+) (phrC) [Bacillus amyloliquefaciens strain C6.7]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718