Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BVAD3_RS15055 Genome accession   NZ_AP024501
Coordinates   3087000..3087140 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain AD-3     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3082000..3092140
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BVAD3_RS15030 (BVAD3_29710) - 3082327..3082710 (-) 384 WP_065180456.1 hotdog fold thioesterase -
  BVAD3_RS15035 (BVAD3_29720) comA 3082732..3083376 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  BVAD3_RS15040 (BVAD3_29730) comP 3083457..3085763 (-) 2307 WP_110124325.1 sensor histidine kinase Regulator
  BVAD3_RS15045 (BVAD3_29740) comX 3085782..3085958 (-) 177 WP_017419424.1 competence pheromone ComX -
  BVAD3_RS15050 (BVAD3_29750) - 3085973..3086869 (-) 897 WP_017419425.1 polyprenyl synthetase family protein -
  BVAD3_RS15055 (BVAD3_29760) degQ 3087000..3087140 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BVAD3_RS15060 (BVAD3_29770) - 3087605..3087946 (+) 342 WP_014418765.1 hypothetical protein -
  BVAD3_RS15065 (BVAD3_29780) - 3087953..3089176 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  BVAD3_RS15070 (BVAD3_29790) - 3089306..3090772 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  BVAD3_RS15075 (BVAD3_29800) - 3090790..3091341 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  BVAD3_RS15080 (BVAD3_29810) - 3091438..3091836 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=85455 BVAD3_RS15055 WP_003152043.1 3087000..3087140(-) (degQ) [Bacillus velezensis strain AD-3]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=85455 BVAD3_RS15055 WP_003152043.1 3087000..3087140(-) (degQ) [Bacillus velezensis strain AD-3]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment