Detailed information    

insolico Bioinformatically predicted

Overview


Name   vraR   Type   Regulator
Locus tag   QYT28_RS07300 Genome accession   NZ_CP129556
Coordinates   1463734..1464363 (-) Length   209 a.a.
NCBI ID   WP_000153535.1    Uniprot ID   W8TS97
Organism   Staphylococcus aureus strain 137G     
Function   repress expression of competence genes (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1456658..1501136 1463734..1464363 within 0


Gene organization within MGE regions


Location: 1456658..1501136
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QYT28_RS07260 (QYT28_07255) - 1456658..1457704 (+) 1047 WP_001145722.1 tyrosine-type recombinase/integrase -
  QYT28_RS07265 (QYT28_07260) yfkAB 1457749..1458894 (+) 1146 WP_416470791.1 radical SAM/CxCxxxxC motif protein YfkAB -
  QYT28_RS07270 (QYT28_07265) - 1459154..1459684 (-) 531 WP_000184383.1 acyl-CoA thioesterase -
  QYT28_RS07275 (QYT28_07270) - 1459774..1461030 (-) 1257 WP_001793983.1 aminopeptidase -
  QYT28_RS07280 (QYT28_07275) - 1461033..1461233 (-) 201 WP_000180460.1 DUF1128 family protein -
  QYT28_RS07285 (QYT28_07280) - 1461380..1461844 (+) 465 WP_000228670.1 low molecular weight protein-tyrosine-phosphatase -
  QYT28_RS07290 (QYT28_07285) - 1461851..1462126 (+) 276 WP_000428172.1 YtxH domain-containing protein -
  QYT28_RS07295 (QYT28_07290) - 1462404..1463621 (+) 1218 WP_000037081.1 YihY/virulence factor BrkB family protein -
  QYT28_RS07300 (QYT28_07295) vraR 1463734..1464363 (-) 630 WP_000153535.1 two-component system response regulator VraR Regulator
  QYT28_RS07305 (QYT28_07300) vraS 1464353..1465396 (-) 1044 WP_001017131.1 sensor histidine kinase Regulator
  QYT28_RS07310 (QYT28_07305) liaF 1465393..1466094 (-) 702 WP_000149064.1 cell wall-active antibiotics response protein LiaF -
  QYT28_RS07315 (QYT28_07310) - 1466109..1466495 (-) 387 WP_001110178.1 hypothetical protein -
  QYT28_RS07320 (QYT28_07315) map 1466712..1467470 (-) 759 WP_123090064.1 type I methionyl aminopeptidase -
  QYT28_RS07325 (QYT28_07320) - 1468114..1469100 (+) 987 WP_001014423.1 FUSC family protein -
  QYT28_RS07330 (QYT28_07325) - 1469289..1469702 (-) 414 WP_001643743.1 hypothetical protein -
  QYT28_RS07335 (QYT28_07330) - 1469731..1469841 (-) 111 WP_001790257.1 hypothetical protein -
  QYT28_RS07340 (QYT28_07335) - 1469927..1470658 (-) 732 WP_000544973.1 type 1 glutamine amidotransferase -
  QYT28_RS07345 (QYT28_07340) murT 1470660..1471973 (-) 1314 WP_001250339.1 lipid II isoglutaminyl synthase subunit MurT -
  QYT28_RS07350 (QYT28_07345) ftnA 1472265..1472765 (+) 501 WP_000949466.1 H-type ferritin FtnA -
  QYT28_RS07355 (QYT28_07350) - 1472847..1472939 (-) 93 WP_001790679.1 hypothetical protein -
  QYT28_RS07360 (QYT28_07355) - 1473156..1473710 (+) 555 WP_000613738.1 3'-5' exonuclease -
  QYT28_RS07365 (QYT28_07360) dinB 1473777..1474847 (-) 1071 WP_000140179.1 DNA polymerase IV -
  QYT28_RS07370 (QYT28_07365) - 1475094..1475624 (-) 531 WP_000548777.1 DUF3267 domain-containing protein -
  QYT28_RS07375 (QYT28_07370) rlmD 1475794..1477155 (-) 1362 WP_001147874.1 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD -
  QYT28_RS07380 (QYT28_07375) - 1477236..1478183 (-) 948 WP_001231458.1 diacylglycerol kinase -
  QYT28_RS07385 (QYT28_07380) - 1478935..1479081 (-) 147 WP_001791535.1 hypothetical protein -
  QYT28_RS07390 (QYT28_07385) gatB 1479120..1480547 (-) 1428 WP_000545373.1 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB -
  QYT28_RS07395 (QYT28_07390) gatA 1480560..1482017 (-) 1458 WP_000027924.1 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA -
  QYT28_RS07400 (QYT28_07395) gatC 1482019..1482321 (-) 303 WP_000170162.1 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC -
  QYT28_RS07405 (QYT28_07400) putP 1482688..1484226 (+) 1539 WP_416470792.1 sodium/proline symporter PutP -
  QYT28_RS07410 (QYT28_07405) - 1484315..1485514 (-) 1200 WP_000831695.1 CamS family sex pheromone protein -
  QYT28_RS07415 (QYT28_07410) ligA 1485527..1487530 (-) 2004 WP_000774552.1 NAD-dependent DNA ligase LigA -
  QYT28_RS07420 (QYT28_07415) pcrA 1487534..1489726 (-) 2193 WP_000992924.1 DNA helicase PcrA -
  QYT28_RS07425 (QYT28_07420) - 1489723..1490415 (-) 693 WP_000272063.1 heptaprenylglyceryl phosphate synthase -
  QYT28_RS07430 (QYT28_07425) - 1490598..1490900 (-) 303 WP_001165363.1 YerC/YecD family TrpR-related protein -
  QYT28_RS07435 (QYT28_07430) purB 1491009..1492304 (-) 1296 WP_160200084.1 adenylosuccinate lyase -
  QYT28_RS07440 (QYT28_07435) scpA 1493155..1494321 (+) 1167 WP_000827736.1 cysteine protease staphopain A -
  QYT28_RS07445 (QYT28_07440) - 1494352..1494675 (+) 324 WP_000434532.1 staphostatin A -
  QYT28_RS07450 (QYT28_07445) - 1494969..1495142 (-) 174 WP_000669861.1 NETI motif-containing protein -
  QYT28_RS07455 (QYT28_07450) - 1495123..1495725 (-) 603 WP_000011542.1 DUF2179 domain-containing protein -
  QYT28_RS07460 (QYT28_07455) nadE 1495995..1496816 (-) 822 WP_000040861.1 ammonia-dependent NAD(+) synthetase -
  QYT28_RS07465 (QYT28_07460) - 1496809..1498278 (-) 1470 WP_000284434.1 nicotinate phosphoribosyltransferase -
  QYT28_RS07470 (QYT28_07465) - 1498462..1499538 (+) 1077 WP_000897633.1 nitric oxide synthase oxygenase -
  QYT28_RS07475 (QYT28_07470) - 1499558..1500076 (+) 519 Protein_1443 prephenate dehydratase domain-containing protein -
  QYT28_RS07480 (QYT28_07475) - 1500189..1501136 (+) 948 WP_000121211.1 IS30-like element ISSau1 family transposase -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 23559.32 Da        Isoelectric Point: 5.3935

>NTDB_id=854311 QYT28_RS07300 WP_000153535.1 1463734..1464363(-) (vraR) [Staphylococcus aureus strain 137G]
MTIKVLFVDDHEMVRIGISSYLSTQSDIEVVGEGASGKEAIAKAHELKPDLILMDLLMEDMDGVEATTQIKKDLPQIKVL
MLTSFIEDKEVYRALDAGVDSYILKTTSAKDIADAVRKTSRGESVFEPEVLVKMRNRMKKRAELYEMLTEREMEILLLIA
KGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAVIYAFQHNLIQ

Nucleotide


Download         Length: 630 bp        

>NTDB_id=854311 QYT28_RS07300 WP_000153535.1 1463734..1464363(-) (vraR) [Staphylococcus aureus strain 137G]
ATGACGATTAAAGTATTGTTTGTGGATGATCATGAAATGGTACGTATAGGAATTTCAAGTTATCTATCAACGCAAAGTGA
TATTGAAGTAGTTGGTGAAGGCGCTTCTGGTAAAGAAGCAATTGCCAAAGCCCATGAGTTGAAGCCAGATTTAATATTAA
TGGATTTACTTATGGAAGACATGGATGGTGTAGAAGCGACGACTCAGATTAAAAAAGATTTACCGCAAATTAAAGTATTA
ATGTTAACTAGTTTTATTGAAGATAAAGAGGTATATCGTGCATTAGATGCAGGTGTCGATAGTTACATTTTAAAAACAAC
AAGTGCAAAAGATATCGCCGATGCAGTTCGTAAAACTTCTAGAGGAGAATCTGTTTTTGAACCGGAAGTTTTAGTGAAAA
TGCGTAACCGTATGAAAAAGCGCGCAGAGTTATATGAAATGCTTACAGAACGAGAAATGGAAATATTATTATTGATTGCG
AAAGGTTACTCAAATCAAGAAATTGCTAGTGCATCGCATATTACTATTAAAACGGTTAAGACACATGTGAGTAACATTTT
AAGTAAGTTAGAAGTGCAAGATAGAACACAAGCTGTTATCTATGCATTCCAACATAATTTAATTCAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB W8TS97

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  vraR Staphylococcus aureus N315

100

100

1

  degU Bacillus subtilis subsp. subtilis str. 168

34.821

100

0.373