Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   BVAD3_RS01945 Genome accession   NZ_AP024501
Coordinates   391246..391365 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain AD-3     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 386246..396365
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BVAD3_RS01930 (BVAD3_03450) - 387858..388541 (+) 684 WP_022552587.1 response regulator transcription factor -
  BVAD3_RS01935 (BVAD3_03460) - 388528..389955 (+) 1428 WP_089072406.1 HAMP domain-containing sensor histidine kinase -
  BVAD3_RS01940 (BVAD3_03470) rapC 390114..391262 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  BVAD3_RS01945 phrC 391246..391365 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  BVAD3_RS01950 - 391515..391610 (-) 96 WP_021495118.1 YjcZ family sporulation protein -
  BVAD3_RS01955 (BVAD3_03480) - 391705..393069 (-) 1365 WP_045508518.1 aspartate kinase -
  BVAD3_RS01960 (BVAD3_03490) ceuB 393483..394436 (+) 954 WP_014416904.1 ABC transporter permease Machinery gene
  BVAD3_RS01965 (BVAD3_03500) - 394426..395373 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  BVAD3_RS01970 (BVAD3_03510) - 395367..396125 (+) 759 WP_012116804.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=85405 BVAD3_RS01945 WP_003156334.1 391246..391365(+) (phrC) [Bacillus velezensis strain AD-3]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=85405 BVAD3_RS01945 WP_003156334.1 391246..391365(+) (phrC) [Bacillus velezensis strain AD-3]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment